|
current user: public |
|
Query: PF14117.6; D0J295_COMT2/9-67; Domain of unknown function (DUF4287 topsan), from PfamA32U |
. 10 . 20 . 30 . 40 . 50 . | |||||||
# | Score | Template | Links and tools | %id | First | GPASYFPSIEKAYGKPVTHWLKILDELRDKKHMEQVAHLKLEHGIGHGHANALVAYHRA | Last |
1 | -4.490 | IDP95077 ATP-dependent Clp protease proteolytic subunit 2 [Peptoclostridium difficile 630] YP_001089868 [Peptoclostridium difficile 630] | ali follow.. | 9 | 148 | ..ERLDKILSENTGKSIEDIRRDTDRD---------NFMTALEAKEYGLIDYIMN.... | 191 |
2 | -4.490 | IDP01974 gene: clpP; ATP-dependent Clp protease proteolytic subunit [Listeria monocytogenes EGD-e] lmo2468 [Listeria monocytogenes EGD-e] | ali follow.. | 9 | 148 | ..ERMNTIMAEKTGQPYEVIARDTDRD---------NFMTAQEAKDYGLIDDIII.... | 191 |
3 | -4.460 | IDP01433 gene: clpP; ATP-dependent Clp protease proteolytic subunit VC1922 [Vibrio cholerae O1 biovar El Tor str. N16961] | ali follow.. | 11 | 153 | ..NKLNRLLAEHTGQPIEVIERDTDRD---------NFMSADQAVEYGLVDAVLK.... | 196 |
4 | -4.430 | IDP01711 gene: clpP; ATP-dependent Clp protease proteolytic subunit [Bacillus anthracis str. `Ames Ancestor`] GBAA5380 [Bacillus anthracis str. `Ames Ancestor`] | ali follow.. | 11 | 148 | ..EKLNQILADRTGQPLEVLQRDTDRD---------NFMTAEKALEYGLIDKIFT.... | 191 |
5 | -4.430 | IDP01105 ATP-dependent Clp protease proteolytic subunit 1 (Endopeptidase Clp 1) BA_2788 [Bacillus anthracis str. Ames] | ali follow.. | 13 | 148 | ..HDINKMIAEKTGQPIERVAHDTERD---------YFMTAEEAKAYGIVDDVVT.... | 191 |
6 | -4.430 | IDP02821 gene: clpP; ATP-dependent Clp protease subunit P [Francisella tularensis subsp. tularensis SCHU S4] FTT0624 [Francisella tularensis subsp. tularensis SCHU S4] | ali follow.. | 9 | 151 | ..DRLNKVLAHHTGQDLETIVKDTDRD---------NFMMADEAKAYGLIDHVIE.... | 194 |
7 | -4.420 | IDP00838 gene: clpP; ATP-dependent Clp protease, proteolytic subunit ClpP SACOL0833 [Staphylococcus aureus subsp. aureus COL] | ali follow.. | 13 | 148 | ..EKLNRILSERTGQSIEKIQKDTDRD---------NFLTAEEAKEYGLIDEVMV.... | 191 |
8 | -4.330 | IDP00742 gene: tsf; elongation factor Ts SACOL1276 [Staphylococcus aureus subsp. aureus COL] | ali follow.. | 15 | 6 | ..AKLVKELREKTGAGMMDCKKALTETD--DIDKAIDYLREK................. | 44 |
9 | -4.320 | IDP02028 gene: clpP; ATP-dependent Clp protease, proteolytic subunit ClpP [Coxiella burnetii RSA 493] CBU_0738 [Coxiella burnetii RSA 493] | ali follow.. | 15 | 149 | ..DQLNQILAKHTGKDIERVEKDTNRD---------YFLTPEEAVEYGLIDSIFK.... | 192 |
10 | -4.280 | IDP90362 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_053 [Chlamydia trachomatis D/UW-3/CX] | ali follow.. | 15 | 3 | ..SERLKKLESEL-HDLTQWMQLVPKKEIERHQEEIRLLESK................. | 43 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7. |