Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF15606.6; RHSA_ECOLI/1298-1372; Bacterial toxin 34, from PfamA32U

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst PGLALDITMIASRGNVADTGITDRVNDIINDRFWSDGKKPDRCDVLQELIDCGDISAKDAKSTQKAWNCRHSRQSLast
1 -6.820IDP04308 hypothetical protein YPCD1.14n [Yersinia pestis CO92] YPCD1.14n [Yersinia pestis CO92]  ali follow..  19  5.........MSRRGNCLDNSPMERVFRSLKSEWLLVGGYMDVHHAVRDIGE........................ 46
2 -6.490IDP05388 hypothetical protein BA_2383 [Bacillus anthracis str. Ames] BA_2383 [Bacillus anthracis str. Ames]  ali follow..  10  100.NIMNEIDTLKIKENISDVQIQEQLVYFTTEFKAASKFMKNAADLIIDGATNSTLNSATIENTKHA......... 164
3 -5.780IDP01828 gene: gshA; glutamate--cysteine ligase [Francisella tularensis subsp. tularensis SCHU S4] FTT0367c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  12.GIERETLRVTDCGNLATSNHPDGLGHKLTNNSITVDFSENLLEAIGELYQLSAFTLDNMHSDEIIL........ 88
4 -4.960IDP04116 gene: sepZ; hypothetical protein Z5122 [Escherichia coli O157:H7 EDL933] Z5122 [Escherichia coli O157:H7 str. EDL933]  ali follow..  27  47.GLALTTTALAALG----TGIAAACSETSSTEYLALGITSGVLGTLTAV.......................... 90
5 -4.690IDP01712 thiJ/pfpI family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA2657 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  14  73....KDLLILPG-GTTWSEEIHQPILERIGQALKIGTIVAAICGATDALANMGYLDTRKHTS............. 129
6 -4.620IDP04078 gene: YPCD1.09c; hypothetical protein YPCD1.09c [Yersinia pestis CO92] YPCD1.09c [Yersinia pestis CO92]  ali follow..  9  17.SVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKDTS 90
7 -4.560IDP06547 set218a-001 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  12  69......LRRLTAQDRRYSVGLMQITSTNFRHYGVSATELLDPCTNLSVFEHILRDCYRRGGTLKRALSCYYS... 134
8 -4.530IDP05562 hypothetical protein lmo2172 [Listeria monocytogenes EGD-e] lmo2172 [Listeria monocytogenes EGD-e]  ali follow..  13  165PSFPIQVALIRGTGNLTLEKEGLHMEVLPIAQAVRNSGGIVIAQV-ESVAKKGSLNPKDVR.............. 229
9 -4.480IDP91627 gene: ECs1561; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB34984 [Escherichia coli O157:H7 str. Sakai]  ali follow..  16  733.GTIWNMAMGAVPGYNALSGVSSILHSAIVK------ESSNICDYIQGAVRIGMVPGTRSDLHSRSLQIKYE... 799
10 -4.110IDP90410 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_663 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  7  69...MMEGNLFGQETGGAALGLDSDGHAVLVRRVPGEVSQEDFASYIESVLNYAEAWLEDLGLSKTE......... 131
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.