Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF01402.21; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family, from PfamA32U

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst LISVHVPKKMLEELDELVRRGIFPNRSEAIRAALRDLLYKLast
1 -4.270sp|Q9NQ89|CL004_HUMAN Uncharacterized protein C12orf4 OS=Homo sapiens GN=C12orf4 PE=2 SV=1  ali follow..  10  465ITTISIPLLLVHDMSEEMTIPWCLRRAELVFKCVKGFMME 504
2 -3.770sp|Q5VZR2|FA22G_HUMAN Protein FAM22G OS=Homo sapiens GN=FAM22G PE=2 SV=2  ali   25  272......DPGLLSYIDKLCSQEDFVTKVEAV.......... 295
3 -3.680sp|P62249|RS16_HUMAN 40S ribosomal protein S16 OS=Homo sapiens GN=RPS16 PE=1 SV=2  ali follow..  21  67............DIRVRVKGGGHVAQIYAIRQSISKALVA 94
4 -3.650sp|Q9H246|CA021_HUMAN Uncharacterized protein C1orf21 OS=Homo sapiens GN=C1orf21 PE=1 SV=1  ali follow..  27  98........EFFRMLDEKIEKGDYCSEEEDI.......... 120
5 -3.640sp|Q9ULD2|MTUS1_HUMAN Microtubule-associated tumor suppressor 1 OS=Homo sapiens GN=MTUS1 PE=1 SV=2  ali   6  69..NISLSLQGVEVFGHEKSSSDFISKQVLDMHK....... 99
6 -3.640sp|Q9UPU5|UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens GN=USP24 PE=1 SV=3  ali   20  14VVNVMQRDSIPSEVDYETRQGVYSICLQLARFLL...... 47
7 -3.640sp|Q8N960|CE120_HUMAN Centrosomal protein of 120 kDa OS=Homo sapiens GN=CEP120 PE=2 SV=2  ali   30  196.......TRLIEERDTLMRTGVYNHEDRIISELIREILAK 231
8 -3.550sp|A6NNL0|FA22B_HUMAN Protein FAM22B OS=Homo sapiens GN=FAM22B PE=2 SV=2  ali   25  259......DPGLLSYIDKLCSQKDFVTKVEAV.......... 282
9 -3.520sp|Q5SRE5|NU188_HUMAN Nucleoporin NUP188 homolog OS=Homo sapiens GN=NUP188 PE=1 SV=1  ali   9  1.VKGSLDQSLKDTLKKFSIEKRFAYWSGYVKSLA...... 33
10 -3.110sp|Q5T5J6|CA026_HUMAN Uncharacterized protein C1orf26 OS=Homo sapiens GN=C1orf26 PE=2 SV=1  ali   14  118.LVLIIPWVVMQELDRMKEGKLLKRAQHKAIPAVH..... 151
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.