current user: public

If you have questions about the server, please let us know.

Query: PF02826.19; Q98GE4_RHILO/107-283; D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain, from PfamA32U

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MFTALALLRQFRRVDRDLRAKGWLAGREHANANIELAGKTIGIVGLGAVGQAVGHIAAHGFDLKVVATTRSMQPAPEKVGFLSIDALVEQSDIIVLCCPLTPETRGLISRERIARMKPNALLINVSRGPVVDDDALIEALREGRIGGAALDVFSTQPLSYNHPYFGFDNVIITPHMALast
1 -72.400sp|Q9UBQ7|GRHPR_HUMAN Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens GN=GRHPR PE=1 SV=1  ali follow..  35  116VSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIAR-RLKPFGVQRFLYTGRQPAAEFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIG 295
2 -65.900sp|P56545|CTBP2_HUMAN C-terminal-binding protein 2 OS=Homo sapiens GN=CTBP2 PE=1 SV=1  ali follow..  35  139ICHILNLYRRNTWLYQALREGTRVQSREVASGAARIRGETLGLIGFGRTGQAVAV-RAKAFGFSVIFYDPYLQDGIERSRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSAQGPLKDAPNLICTPHTA 323
3 -65.400sp|Q13363|CTBP1_HUMAN C-terminal-binding protein 1 OS=Homo sapiens GN=CTBP1 PE=1 SV=2  ali follow..  35  133LCHILNLYRRATWLHQALREGTRVQSREVASGAARIRGETLGIIGLGRVGQAVAL-RAKAFGFNVLFYDPYLSDGVERARVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSSQGPLKDAPNLICTPHAA 317
4 -65.400sp|O43175|SERA_HUMAN D-3-phosphoglycerate dehydrogenase OS=Homo sapiens GN=PHGDH PE=1 SV=4  ali follow..  30  111CGMIMCLARQIPQATASMKDGKWERKK---FMGTELNGKTLGILGLGRIGREVAT-RMQSFGMKTIGYDPIISPESFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEP-PRDRALVDHENVISCPHLG 285
5 -13.200sp|Q96HN2|SAHH3_HUMAN Putative adenosylhomocysteinase 3 OS=Homo sapiens GN=AHCYL2 PE=1 SV=1  ali   21  86...............................TDMMFGGKQVVVCGYGEVGKGCCA-ALKAMGSIVYVTECALQACMDGFRLVKLNEVIRQVDIVITCT----GNKNVVTREHLDRMKNSCIVCNMG................................................... 179
6 -12.700sp|O43865|SAHH2_HUMAN Putative adenosylhomocysteinase 2 OS=Homo sapiens GN=AHCYL1 PE=1 SV=2  ali follow..  16  275...AMNVNDSVTKQDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCA-ALKALGAIVYITECALQACMDGFRVVKLNEVIRQVDVVITCT----GNKNVVTREHLDRMKNSCIVCNMGH----NTEIDVTSLRTPELT............................... 415
7 -12.100sp|P23526|SAHH_HUMAN Adenosylhomocysteinase OS=Homo sapiens GN=AHCY PE=1 SV=4  ali follow..  20  177...AINVNDSVTKSDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQ-ALRGFGARVIITENALQAAMEGYEVTTMDEACQEGNIFVTTT----GCIDIILGRHFEQMKDDAIVCNIGHFDVIDVKWLNENAVEKVNIKPQVDRYRLK..................... 331
8 -10.500sp|P52209|6PGD_HUMAN 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens GN=PGD PE=1 SV=3  ali follow..  14  1...................................MAQADIALIGLAVMGQNLILNMNDH-GFVVCAFNRTVSKVDDFLALKEMVSKLKKPRRIILLVKAGQAVDDFIEK--VPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGV......................... 128
9 -10.100sp|Q96HN2|SAHH3_HUMAN Putative adenosylhomocysteinase 3 OS=Homo sapiens GN=AHCYL2 PE=1 SV=1  ali   21  237................................DMMFGGKQVVVCGYGEVGKGCCA-ALKAMGSIVYVTECALQACMDGFRLVKLNEVIRQVDI.................................................................................... 300
10 -9.320sp|P31937|3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=HIBADH PE=1 SV=2  ali follow..  14  40......................................TPVGFIGLGNMGNPMAKNLMKH-GYPLIIYDVFPDACKEFQDASSPADVAEKADRIITMLPTSINAIEAYSGANLKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFM.......... 174

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 9 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Godzik A. NERD: a DNA processing-related domain present in the anthrax virulence plasmid, pXO1. Trends Biochem Sci. 2004 Mar;29(3):106-10.