current user: public

If you have questions about the server, please let us know.

Query: PF07837.12; R6RB74_9CLOT/5-181; Formiminotransferase domain, N-terminal subdomain, from PfamA32U

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst LIECVPNYSEGRDLEKIEKIVECFRAKKGVRLLDYQTDPNHNRLVVTVIGEPEPLRDAVVASFGRAVELIDMTKHEGQHPRMGAVDVVPFIPCRNATLEEADALAKEVAKTVGEQYGIPCFLYESSATAPHRANLASIRKGQFEGMAEKMQDTEKWAPDFGPAAPHPTAGVSAVGARLast
1 -81.200sp|O95954|FTCD_HUMAN Formimidoyltransferase-cyclodeaminase OS=Homo sapiens GN=FTCD PE=1 SV=2  ali follow..  40  4LVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQAD-WAPDFGPSSFVPSWGATATGAR 179
2 -9.190sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2  ali   20  129.....PSVRKGVLPRMLEEILKTRFMVKQSMGLKLIANVTFGYTSANFSGRGDSIVHKARETLERAIKLVNDTKKWGARVVYGDTDSM-FVLLKGATKEQSFKIGQEIAEAVTATNPKPVKL....................................................... 268
3 -8.850sp|Q9NZJ4|SACS_HUMAN Sacsin OS=Homo sapiens GN=SACS PE=1 SV=2  ali   108FSAARNDLHKNANEWVCFKCYLSTKLALIAADYAVRGKSDKDVKPTALAQKIEEYSQQLEGLTNDVHTLEAYGVDKTRYPDLLPFPQIPNDRFTSEVAMRVMECTACIIIKLENFMQQKV......................................................... 229
4 -7.560sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2  ali   21  24................................LKLIANVTFGYTSANFSGRGDSIVHKARETLERAIKLVNDTKKWGARVVYGDTDSM-FVLLKGATKEQSFKIGQEIAEAVTATNPKPVKL....................................................... 118
5 -6.900sp|Q9NR71|ASAH2_HUMAN(removed signalp:1-36) Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 SV=2  ali   31.....NQTFQHMVTGILKSIDIAHTNMKPGKI-GNVDGVQINRSPYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGD---LGLISWFAIHPVS-VNSDNVGYASYLLEQEKNKG.............................................................. 147
6 -6.870sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens GN=HADHA PE=1 SV=2  ali   13  41........EGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIFRLVTRFVNEAVMCLQ---EGILATPAEGDIGAVFGLFPLGG-----PFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKK............................................. 160
7 -6.440sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2  ali   17  1..............................................................VELAERM--RKRDPGSAPSLG--DRVPYVIISAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQQLAKPLLRI.......................................... 69
8 -6.380sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens GN=OSBPL8 PE=1 SV=3  ali   12  107IWTLLKQVRPGMD---LSKVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRLKKVVKWYLSGFYKKPKGLKKP---------YNPILGETFRRTNSKTFYIAEQVSHHPPISAFYVSNRKD................................................. 228
9 -6.170sp|Q9H0X9|OSBL5_HUMAN Oxysterol-binding protein-related protein 5 OS=Homo sapiens GN=OSBPL5 PE=1 SV=1  ali   10  71MWTLLKQLRPGMD---LSRVVLPTFVLEPRSFLNKLSDYYYHADLLSRAAVEEDAYSRMKLVLRWYLSGFYKKPKGIKKP---------YNPILGETFRQTDSRTFYIAEQVSHHPPVSAFHVSNRKD................................................. 192
10 -6.000sp|Q8WZ82|OVCA2_HUMAN Ovarian cancer-associated gene 2 protein OS=Homo sapiens GN=OVCA2 PE=1 SV=1  ali follow..  12  115....LLGFSQGAALAAL-ILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLAQFPGAITLTHSGGH----------FIPAAAPQRQAYLKFLDQFAE................................................................... 227

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.