current user: public

If you have questions about the server, please let us know.

Query: PF10177.9; W5KY66_ASTMX/13-159; Uncharacterised conserved protein (DUF2371 topsan), from PfamA32U

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst RQDSLRTKNRAENKRRRKARKKRKNDIVVVKGKLNLCSVSGMAAAFGVLVLMVGIAMAVLGYWPRENLAHTVSLQRVNDATINSTKPIPPASRHVGFFEDFFSNYQYSDNLKVFGPLVMGIGIFLFICANAVLHENRDKKTKIINLRLast
1 -66.600sp|Q69YZ2|T200B_HUMAN Transmembrane protein 200B OS=Homo sapiens GN=TMEM200B PE=2 SV=1  ali follow..  31  13RRSPEGRVSRLGRRLGRRRRPRSPPEPLRVRARLRLRSPSGAFAALGALVVLVGMGIAVAGYWPHRAGAPGSR---------AANASSPQMSELRREGRGGGRAHGPHERLRLLGPVIMGVGLFVFICANTLLYENRDLETRRLRQG 150
2 -63.800sp|A6NKL6|T200C_HUMAN Transmembrane protein 200C OS=Homo sapiens GN=TMEM200C PE=2 SV=2  ali   58  14KQDPLRPPSQIPKRKRK-AKKRRKNDVVVVKGKLKLCSISGLIALCGILVLLVGIAMAVVGYWPKATGVNSSSAGAPRSTPPARAASPSSSSTSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 201
3 -57.800sp|Q86VY9|T200A_HUMAN Transmembrane protein 200A OS=Homo sapiens GN=TMEM200A PE=2 SV=1  ali follow..  44  16RQDSARSQQHVNTQEKKPIRRRPRADVVVVRGKIRLYSPSGFFLILGVLISIIGIAMAVLGYWPQKEH-------FIDAETTLSTNETQVIRNEGGVVVRFFEQHLHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMR 161
4 -38.300sp|A6NKL6|T200C_HUMAN Transmembrane protein 200C OS=Homo sapiens GN=TMEM200C PE=2 SV=2  ali   84  1................................................................................................FFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 51
5 -10.600sp|Q8WVE6|TM171_HUMAN Transmembrane protein 171 OS=Homo sapiens GN=TMEM171 PE=2 SV=3  ali follow..  20  77....ARSRAQLQLRAGLQRGQQMDPDRAFICGE---SRQFAQCLIFGFLFLTSGMLISVLGIWVPGCG------SNWAQEPLNETDTGDSEPRMCGFL-----------SLQIMGPLIVLVGLCFFVVAHVKKRNTLNAGQD..... 194
6 -10.500sp|Q8WUU8|TM174_HUMAN Transmembrane protein 174 OS=Homo sapiens GN=TMEM174 PE=2 SV=1  ali follow..  17  2EQGSGRLEDFPVNVFSVTPYTPSTADIQVSDDD----KAGATLLFSGIFLGLVGITFTVMGWIKYQGVS-------------------------------------HFEWTQLLGPVLLSVGVFILIAVCKFLCKESEERV...... 108
7 -10.100sp|Q2VWP7|PRTG_HUMAN(removed signalp:1-35) Protogenin OS=Homo sapiens GN=PRTG PE=2 SV=1  ali   23  1....................................................................................................VYSGYYHLDQKSMTG-IAVGVGI-ILICVLILIYRSKARKSS..... 44
8 -8.650sp|Q96NU0|CNT3B_HUMAN(removed signalp:1-25) Contactin-associated protein-like 3B OS=Homo sapiens GN=CNTNAP3B PE=2 SV=2  ali   23  167............................................................................................................RDSAVMGGVIAVV-IFILLCITAIIYQQRKNESK..... 206
9 -8.640sp|Q6P995|F171B_HUMAN(removed signalp:1-32) Protein FAM171B OS=Homo sapiens GN=FAM171B PE=1 SV=3  ali   23  19.........................................................................................................YHTVFLTAIGTIVIVIGFFVLLCYCKLEVLKRDQTTSTTHIN 78
10 -8.610sp|Q9C0A0|CNTP4_HUMAN(removed signalp:1-25) Contactin-associated protein-like 4 OS=Homo sapiens GN=CNTNAP4 PE=1 SV=3  ali   23  163............................................................................................................SDSAVIGGLIAVV-IFILLCITAIAYKRSEAKRS..... 204

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35