current user: public

If you have questions about the server, please let us know.

Query: PF10417.9; A4AVJ3_MARSH/157-196; C-terminal domain of 1-Cys peroxiredoxin, from PfamA32U

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst SLQLTAYHKVATPANWEHGQDVVVSPAIPTNEAREMFDKGLast
1 -20.000sp|P30041|PRDX6_HUMAN Peroxiredoxin-6 OS=Homo sapiens GN=PRDX6 PE=1 SV=3  ali follow..  55  166SLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKG 205
2 -14.800sp|P30048|PRDX3_HUMAN Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens GN=PRDX3 PE=1 SV=3  ali follow..  17  218AFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ. 256
3 -14.800sp|Q06830|PRDX1_HUMAN Peroxiredoxin-1 OS=Homo sapiens GN=PRDX1 PE=1 SV=1  ali follow..  23  162AFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK.. 199
4 -13.500sp|Q13162|PRDX4_HUMAN(removed signalp:1-37) Peroxiredoxin-4 OS=Homo sapiens GN=PRDX4 PE=1 SV=1  ali follow..  18  197AFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN.. 234
5 -13.300sp|P32119|PRDX2_HUMAN Peroxiredoxin-2 OS=Homo sapiens GN=PRDX2 PE=1 SV=5  ali follow..  30  161AFQYTDEHGEVCPAGWKPGSDTIKPNV---DDSKEYFSK. 196
6 -6.900sp|P08F94|PKHD1_HUMAN(removed signalp:1-23) Fibrocystin OS=Homo sapiens GN=PKHD1 PE=1 SV=1  ali   15  6....NERIIVEDAVDWRPHDKIVLSSSSYEPHEAEVL... 38
7 -6.670sp|P08F94|PKHD1_HUMAN(removed signalp:1-23) Fibrocystin OS=Homo sapiens GN=PKHD1 PE=1 SV=1  ali   22  91.........LEDAVDWNPGDEVVIISGTGVKGAKPM.... 117
8 -6.440sp|Q86WI1|PKHL1_HUMAN(removed signalp:1-20) Fibrocystin-L OS=Homo sapiens GN=PKHD1L1 PE=2 SV=2  ali   12  10....SKVLSLMDAVDWQEGEEIVITTTSYDFHQTE..... 40
9 -6.240sp|Q86WI1|PKHL1_HUMAN(removed signalp:1-20) Fibrocystin-L OS=Homo sapiens GN=PKHD1L1 PE=2 SV=2  ali   15  195.........LQEAVTWKPGDNIVIASTGHRHSQGE..... 220
10 -5.980sp|P08F94|PKHD1_HUMAN(removed signalp:1-23) Fibrocystin OS=Homo sapiens GN=PKHD1 PE=1 SV=1  ali   17  161.........VEDAVDWRPHDKIVLSSSSYEPHEAEVL... 188

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.