|
current user: public |
|
Query: PF01402.21; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family, from PfamA32U |
. 10 . 20 . 30 . 40 | |||||||
# | Score | Template | Links and tools | %id | First | LISVHVPKKMLEELDELVRRGIFPNRSEAIRAALRDLLYK | Last |
1 | -7.420 | HGC00962 gi|162759780|dbj|BAAZ01005693.1|3.0 TMP01305; | ali follow.. | 27 | 41 | .HSVWLSDDVWQEVDAFYKLDNCPIRNEFAEKALRQYC.. | 77 |
2 | -6.030 | HGC00518 gi|162728471|dbj|BAAY01000490.1|2.0 TMP00574; | ali follow.. | 15 | 58 | .KTLSIPGWLNDAAESA------INFSSVLQKGLKSELG. | 90 |
3 | -1.150 | PB006154 _JGI.0331794_ 2004021056 [Human Gut Community Subject 7] | ali follow.. | 11 | 2 | .SYISVPRDLTKVKSKVM...................... | 18 |
4 | -0.707 | HGC00248 gi|162576253|dbj|BAAV01029229.1|2.0 TMP00024; | ali follow.. | 7 | 95 | ......EKKIESAIRIVGNENPYHPIRDYLNGL....... | 121 |
5 | -0.693 | PB019278 gi|154508461|ref|ZP_02044103.1| hypothetical protein ACTODO_00960 [Actinomyces odontolyticus ATCC 17982]gi|153798095|gb|EDN80515.1| hypothetical protein ACTODO_00960 [Actinomyces odontolyticus ATCC 17982] | ali follow.. | 17 | 24 | .AKVELRAMMEDAYADAIASG--MTHNEAVGRVITDF... | 57 |
6 | -0.562 | PB001708 Q3IRP6_NATPD/1-505 PB001708; Pfam-B_1708; | ali follow.. | 16 | 1 | .MNEGIPEQLIRRLSDASR..................... | 18 |
7 | -0.560 | PB014998 gi|86133284|ref|ZP_01051866.1| hypothetical protein MED152_01230 [Tenacibaculum sp. MED152]gi|85820147|gb|EAQ41294.1| hypothetical protein MED152_01230 [Polaribacter dokdonensis MED152] | ali follow.. | 13 | 157 | .....VHPELKHLIETKII-----HESKGTKARGKHILNL | 186 |
8 | -0.557 | PB144506 _Gut.Meta.Jp.0101058_ gi|162866171|dbj|BABB01003836.1||1 (- 121:946~0 complete) | ali follow.. | 10 | 77 | .LKITIDENLFPLLSIKSNNG................... | 96 |
9 | -0.488 | PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498; | ali follow.. | 15 | 121 | ..QIQMPISIKEQALFIVSEHRIQHRHD............ | 146 |
10 | -0.388 | HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234; | ali follow.. | 22 | 27 | ...FKVPEGYFENLTSEVMGKLPEKEGPAF.......... | 53 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Friedberg I, Harder T, Kolodny R, Sitbon E, Li Z, Godzik A. Using an alignment of fragment strings for comparing protein structures. Bioinformatics. 2007 Jan 15;23(2):e219-24. |