current user: public
If you have questions about the server, please let us know.

Query: PF05635.11; K7WXD0_9NOST/8-110; 23S rRNA-intervening sequence protein, from PfamA32U

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst EDLIVWQKAHQFVLEVYQITGNFPKSEIYGLASQFRRASISIPANIAEGFKKKGDLDKVRFMNIAQASLEECRYYLILTKDLGYANTSESMLKLQEVSRLLDSLast
1 -2.910PB034180 _Gut.Meta.Jp.0112129_ gi|163310377|dbj|BABD01000320.1||2 (+ 509:1679~0 complete)  ali follow..  10  64SELGLWQSFTAEHKRLYGKYLPFYPTNSNYVADEINEQAGIFYGILEEAYENAPENESLNHYFDHPGTAVEADRKLTWLFGHSYLTEPSMLPYIEQIAP.... 194
2 -2.790PB002794 gi|86143885|ref|ZP_01062253.1| hypothetical protein MED217_03525 [Flavobacterium sp. MED217]gi|85829592|gb|EAQ48055.1| hypothetical protein MED217_03525 [Leeuwenhoekiella blandensis MED217]  ali follow..  22  271.RVYVEQKNFSKAKQAYRLSLKYPEKSGF-FADQIRA.................................................................. 306
3 -2.760HGC00024 gi|162813637|dbj|BABA01031072.1|2.0 TMP01508;  ali follow..  18  183.......................PQTEVYSVEKDLKTAIDLLPVHYLRGIWRLPG................................................ 215
4 -2.670PB044572 Q8A533_BACTN/1-343 PB044572; Pfam-B_44572;  ali follow..  18  211....VYESMQVFVPDTWEHFYFNPTLSPFKVPFILSVFLLSI------------------FLIVALAVLDDLFRQLTPAAAVFYL.................. 275
5 -2.520PB008694 Q9F6U1_BACTN/1-190 PB008694; Pfam-B_8694;  ali follow..  12  22.RFTVWRRSWAATSK--------PPSGNLPKSGETRKQPTI--INEKRKMRMNLPKVKMLQVSKC...................................... 79
6 -2.460PB033130 gi|160880323|ref|YP_001559291.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]gi|160428989|gb|ABX42552.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]  ali follow..  12  108.........................RSKLREAKLLRENRIE---SYYDEALAENVPDAKEILHLAKGNFMEIYRFLTVDGNLKTLKVKDYKDVTASV...... 187
7 -2.160PB017124 _Gut.Meta.Jp.0039711_ gi|162659581|dbj|BAAX01000024.1||2 (+ 385:1498~0 complete)  ali follow..  13  255...........................................DWAVDSDGNPKHLDHADFIRIQCGWTGETSTEVGRITN...................... 298
8 -2.100PB022697 Q5LAY4_BACFN/1-165 PB022697; Pfam-B_22697;  ali follow..  7  13AGEGMDEFIQVFTDKYKEVIGGELTAETMPLLTGEQHSLLAY-DEVMFG--------FCQLIQNGYGGYIFDNP---FAKVMRLWGAEDFSKLVYKAKKIYDA 108
9 -1.960HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  5  14...........GAAFMVGCGKQVPE----NIIQPDRMENILYDYHLSISMGNNLSYSDNYQKEAYKNYVFE--TEAEFDSSMVWYTREELASLYKKLGERFR. 104
10 -1.820HGC00518 gi|162728471|dbj|BAAY01000490.1|2.0 TMP00574;  ali follow..  10  53................................FKPVKKTLSIPGWLND-AAESAHINFSSVLQKGLKSELGM............................... 91
FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 8 5 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.