current user: public

If you have questions about the server, please let us know.

Query: PF08793.10; Q0E553_SFAVA/142-176; 2-cysteine adaptor domain, from PfamA32U

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .
# Score Template Links and tools%idFirst YCTNFHRDESRNPLTGKKLVPTSPIRKAWHKMCSGLast
1 -1.200PB007843 JCVI_PEP_1096682172521 /source_dna_id=JCVI_ORF_1096682172520 /offset=0 /translation_table=11 /length=152 /full_length=152  ali follow..  20  92........FDVFQDYDEERVYPSDIKKQWYNI... 117
2 -1.050HGC00593 gi|162858151|dbj|BABB01011554.1|1.0 TMP00709;  ali follow..  17  19.....NRIDVPDDGFSRRVMRRLPISRLWTAVCV. 52
3 -0.896PB001030 Q6D4H5_ERWCT/1-146 PB001030; Pfam-B_1030;  ali follow..  21  69HCYQPARREAIKAISGPRMLLRHPILAIRHLI... 103
4 -0.866HGC00311 gi|163635536|dbj|BABG01000737.1|2.0 TMP00178;  ali follow..  15  3......KPKNLEQLRAEKEQVETQLAQEQHKL... 28
5 -0.609PB047496 gi|150008556|ref|YP_001303299.1| hypothetical protein BDI_1942 [Parabacteroides distasonis ATCC 8503]gi|149936980|gb|ABR43677.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  21  36.......KNAVTSVTGGKAVTFENLQGTWM..... 58
6 -0.587PB092941 Q45777_BACTN/1-139 PB092941; Pfam-B_92941;  ali follow..  16  114...DFNMADRMNELLRQGTHIYRRIKRG....... 138
7 -0.563PB004996 Q5NNS6_ZYMMO/1-150 PB004996; Pfam-B_4996;  ali follow..  20  57......NDGKQTPCKGHPVFLAQHATGTWHRIEAG 93
8 -0.484PB006154 _JGI.0331794_ 2004021056 [Human Gut Community Subject 7]  ali follow..  21  14......KSKVMFNLTKRQLI............... 27
9 -0.448HGC00928 gi|162868028|dbj|BABB01001979.1|3.0 TMP01255;  ali follow..  25  183...................IHQSGMLYDWHNYWNG 198
10 -0.436HGC00690 gi|162868815|dbj|BABB01001192.1|3.0 TMP00870;  ali follow..  17  106.CIAVALAEILHPIIYKRMKLRAGLGIIVISMAIG 141

FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 6 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.