current user: public
If you have questions about the server, please let us know.

Query: PF10417.9; A4AVJ3_MARSH/157-196; C-terminal domain of 1-Cys peroxiredoxin, from PfamA32U

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst SLQLTAYHKVATPANWEHGQDVVVSPAIPTNEAREMFDKGLast
1 -1.840HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234;  ali follow..  12  20..KVGKKNSFKVPEGYFENLTSEVMGKLPEKEGPA..... 52
2 -1.660PB045813 Q5LF03_BACFN/1-275 PB045813; Pfam-B_45813;  ali follow..  23  15........SMIYPSDWSEFED................... 27
3 -1.080HGC00787 gi|162657578|dbj|BAAX01002027.1|2.0 TMP01033;  ali follow..  20  65.IEVFRTEDQDIEHNFEFGRPVMFFKAGETKTAQT..... 98
4 -1.020HGC00965 gi|163282470|dbj|BABD01028218.1|2.0 TMP01310;  ali follow..  19  96VAQYLNDAYNAEPERWSAHPSIL-TPPAPEPDAETQ.... 135
5 -0.853PB009233 Q7MX23_PORGI/1-175 PB009233; Pfam-B_9233;  ali follow..  9  33..DERILYRQVPHGRWQKRDVLDYEILIPDYTRS...... 64
6 -0.733PB009661 _Gut.Meta.Jp.0000785_ gi|162567239|dbj|BAAU01000237.1||2 (- 3549:4008~0 complete)  ali follow..  10  52.....DDRNLGGLPDWGVIYEMVHNRWSYNRYLNE..... 81
7 -0.714PB047024 _Gut.Meta.Jp.0098985_ gi|162869273|dbj|BABB01000734.1||6 (+ 5047:5650~0 complete)  ali follow..  7  103GMKMPIRYVCEMFIDRVSASKNYQKEKYTDKSALEYYEKS 142
8 -0.660PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  10  338NVEFNNSSLNMRLLNWTSTR.................... 357
9 -0.321PB071107 _Gut.Meta.Jp.0066071_ gi|162701604|dbj|BAAY01026246.1||2 (+ 344:749~0 complete)  ali follow..  13  25.................EEGSVVRIFPLTEEIENVEWLPG 47
10 -0.278PB002104 Q72PH8_LEPIC/1-220 PB002104; Pfam-B_2104;  ali follow..  7  81.FPFSILYFVGFFFDWSGNNPVGYNEYDENGKYVKAYEEN 128
FFAS is supported by the NIH grant R01-GM087218-01
1 4 4 8 1 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.