current user: public

If you have questions about the server, please let us know.

Query: PF11944.8; Y2971_PHOPR/1-125; Protein of unknown function (DUF3461 topsan), from PfamA32U

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MYPHLTSIGIEQPEAIERYSLRQEAANDILKVYFAKNKGELFAKSVKFKFPRQRKSVLVNSGSREYKEITEINRTLTHIIDELDIITKRKHTEVDIKKKILGDLRHLERVVSHKISEIEADLEKLLast
1 -3.880PB012472 gi|62259485|gb|AAX77857.1| unknown protein [synthetic construct]  ali follow..  16  242...........................................................................IAEKKEILRQITELTKQNNSLKKEHKKAINFSDKALNMQIQVNRKSIEDL 292
2 -3.250HGC00024 gi|162813637|dbj|BABA01031072.1|2.0 TMP01508;  ali follow..  115AYTQIAKYNT--LENITDCPMEESKKEQWS------AEVKCLRAYFFLNLAFYYTDV----------------PMPLKTLSVDEANSISQTPQTEVYSQVEKDLKTAIDLLPVHYLRGIWRLPG. 215
3 -3.160PB202086 Q8G498_BIFLO/2-200 PB202086; Pfam-B_202086;  ali follow..  137..........................................................AVKLNEQADWYETHEKSLSKAVRAVVE-SKAAKRLDDAKTNLTAKLDEASKLLADSDGKVADN.... 198
4 -3.160HGC00803 gi|163280588|dbj|BABD01030100.1|2.0 TMP01051;  ali follow..  16  33....................................................................VDKVKDELQKVIDLLESGETDTEVIQETLDEAVCGINDLQEEFDENDSEIETVARD. 88
5 -3.110PB025553 _HOMD.0078651_ pint_c_1_4510 Prevotella intermedia 17 [1755134 - 1755736] ORF  ali follow..  17  10.............KSIAEYLLYMWQIEDIIRVY-------------GCSLTRIRKEY-IDKFDYTDEQKEEEEDWFGDLVRMMNQEGCRENGHLQINKVVMQALTELHTQLLASSKF........ 99
6 -3.090HGC00150 gi|162733542|dbj|BAAZ01030454.1|1.0 TMP01074;  ali follow..  12  2.......LGITNVPDKKNYAIDELGLSAARNLYAGKANAQVVNYLLESRFLDLTYILEQYFNDTVAAGYAAQNQLYTTISSLTRKTVKTEAGEQAARD----DLVTIENQFMLAVKEVKKEIGN. 128
7 -2.860PB000520 Q9RVX4_DEIRA/1-194 PB000520; Pfam-B_520;  ali follow..  14  45....................................................................ISGAGTLIMSTSTRVGRATDRVRGLTSRFKQLVSAEGQNEPLAREEKRLIIRQLPRL 101
8 -2.600PB001708 Q3IRP6_NATPD/1-505 PB001708; Pfam-B_1708;  ali follow..  10  366.VMAMEPYG-QDTRGLDEVWFFNAETGET--VYYETGGDTLLGPERATDIVRAEDTRTDWDTAGSDGEFRAVEPVPVVVDEELWWHSK-PTDNSDVTRNVFVSAHSGAAVELHDTEAVIDFIEG. 486
9 -2.520HGC00429 gi|162734516|dbj|BAAZ01029480.1|1.0 TMP00411;  ali follow..  143.............REMQDYELRPSRNNLDIRRQMDAQAQVVGKWEDAHHVPDQKRLTWFYPDFGSYVVKEYVTP---------DQLAVRVRSIERQEAARAHKEAKRQPPIAEQLKAAQREAQG. 244
10 -2.320PB060121 Q64SA7_BACFR/1-251 PB060121; Pfam-B_60121;  ali follow..  13  13.YPTLARFGLTDLPLCILKEIGKGGYSPVLPMRVTNENGEVIESRSRFAFIRMDEVDVVFYPTLKSSPLECYNEEQQKQLLDGKSIIADVAMADGRRSKAFVQIDETKQVMYVPTPIIARNLKV. 143

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.