Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: PF14117.6; D0J295_COMT2/9-67; Domain of unknown function (DUF4287 topsan), from PfamA32U

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .
# Score Template Links and tools%idFirst GPASYFPSIEKAYGKPVTHWLKILDELRDKKHMEQVAHLKLEHGIGHGHANALVAYHRALast
1 -2.430HGC00965 gi|163282470|dbj|BABD01028218.1|2.0 TMP01310;  ali follow..  18  92GRTAVAQYLNDAYNAEPERWSA..................................... 113
2 -1.800PB018258 Q7MT99_PORGI/1-157 PB018258; Pfam-B_18258;  ali follow..  78GITHLYDELPHHAVQSLKH--RLLTYFGKTTY---YRIYRKERYITIQEQDYIRDSFVR 131
3 -1.580PB032818 Q5LA03_BACFN/1-211 PB032818; Pfam-B_32818;  ali follow..  12  42GITNIRFLPDVANFKRLFKVATQGGKLGLAEKSASRKMLMQDYGISESFFKEIDTSIK. 99
4 -1.470PB092941 Q45777_BACTN/1-139 PB092941; Pfam-B_92941;  ali follow..  16GIFCVMEEFDALLSNIIDSTLGPRTKTFGYQYSEIFRSLMCVYFCGGSCVEDI...... 68
5 -1.450PB002589 gi|91201099|emb|CAJ74158.1| hypothetical protein [Candidatus Kuenenia stuttgartiensis]  ali follow..  18......KNLRTDDGLRLE---KGLIRGSVEIHVFASDWIHHKHENQKTYDAVCLHVV.. 89
6 -1.280HGC00870 gi|163286116|dbj|BABD01024572.1|2.0 TMP01154;  ali follow..  93..NQALAALRKSGAGTFPYKAILTPTNQNWNALQCFSEIRREH................ 133
7 -1.280PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  15  79......QKVRNAVYGNLKLMKNTLTEKQYSDYLRLMALTLRNKGID............. 118
8 -1.250HGC00522 gi|163636101|dbj|BABG01000172.1|3.0 TMP00580;  ali follow..  150..RETILRLKYETPETEKEYYQAVIRDGVRDYSGFKEWRKQH................. 193
9 -1.180HGC00518 gi|162728471|dbj|BAAY01000490.1|2.0 TMP00574;  ali follow..  16  55.........PVKKTLSIPGWLDAAESAHINFSSVLQKGLKSELGM.............. 91
10 -1.160PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali follow..  17  88.........EEYNTEAVEEFEEILST---LQEEEVPSWIRS.................. 116

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.