current user: public

If you have questions about the server, please let us know.

Query: PF03171.20; ACCO1_ARATH/158-259; 2OG-Fe(II) oxygenase superfamily, from PfamA32U

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst PAFGTKVAKYPECPRPELMRGLREHTDAGGIILLLQDDQVPGLEFFKDGKWVPIPPSKNNTIFVNTGDQLEILSNGRYKSVVHRVMTVKHGSRLSIATFYNPLast
1 -5.610sp|Q8N7U6|EFHB_HUMAN EF-hand domain-containing family member B OS=Homo sapiens GN=EFHB PE=2 SV=4  ali   15  53...........PAPRIRRISDRTNYGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKL---SDEEFENVWNLASKKHHRGEVCVENI... 137
2 -5.480sp|O43247|EAN57_HUMAN Protein EAN57 OS=Homo sapiens GN=EAN57 PE=2 SV=2  ali   12  10.GYNMRSNLFRGAAEETKSLMKASYTPEVIEKSVRDLEHWHGRKTDDLGRWHQ-----KNAMNLNLQKALEEKYGENSKSKSSK.................. 87
3 -5.210sp|A6H8Z2|CI128_HUMAN Uncharacterized protein C9orf128 OS=Homo sapiens GN=C9orf128 PE=2 SV=2  ali   12  5................EVAKAMHREEFGAQVNNLFQWEKDAALNAIQTGLYIGWRCPHYLWDCFRIGDESRCFCGHLLR--EHRIISDIS............ 76
4 -5.210sp|Q8ND61|CC020_HUMAN Uncharacterized protein C3orf20 OS=Homo sapiens GN=C3orf20 PE=1 SV=2  ali   11  57....................GCVHYNLKTSCPYVLILDEEGGTTNDQQGSWTSRTE-TLLSLEYKVNEEMKLKVLGQ-DSITVTFTSLNETVTLTVSA.... 138
5 -5.080sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=3  ali   1..QDLLLEIYRSIGEPDSLYGCGGGKMLQPITRL--------RTYEHEAMWGKALVTYDLETAIPSSTRQAGIIQALQNLGLCHILSVYLKGLDY....... 85
6 -4.840sp|Q8WU66|TSEAR_HUMAN Protein TSPEAR OS=Homo sapiens GN=TSPEAR PE=2 SV=2  ali   20  1.....EVLKYPYETNIRVTLGPQPPCTEVEDAQFWFDASRKGLYLCVGNEWVSV................................................ 49
7 -4.840sp|P38435|VKGC_HUMAN Vitamin K-dependent gamma-carboxylase OS=Homo sapiens GN=GGCX PE=1 SV=2  ali   18  32...............PGLHLENFVSEDLGNTSIQLLQGEVT-VELVAEQKNQTLRE----------GEKMQL------AGEYHKVYTTSPSPSCYMYVYVNT 102
8 -4.820tr|E5RG91|E5RG91_HUMAN Uncharacterized protein OS=Homo sapiens GN=VPS37A PE=4 SV=1  ali   13  65PSFGVLSNLPLPIPTVDASIPTSQNGELSELRSLYNCEHFPTVVIFKESRYIDISIGPKFTFTDSVKNILQTALCSIVVDVLFDFKVKTGSLRCICKNYLEP 179
9 -4.770sp|P10242|MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens GN=MYB PE=1 SV=2  ali   20  3PTQNHTCS-YPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPA-DPGSLPEESASPARCMIVHQGTILDNVKN........................... 75
10 -4.710sp|Q7L0X2|F194A_HUMAN Protein FAM194A OS=Homo sapiens GN=FAM194A PE=2 SV=1  ali   13  1.....................................NILGGQYSDQAGAWTSSPFVSFKPVFLALNRYIGVRILEQ-DKISITFLAMGQQARISVGT.... 70

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.