current user: public

If you have questions about the server, please let us know.

Query: PF08793.10; Q0E553_SFAVA/142-176; 2-cysteine adaptor domain, from PfamA32U

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .
# Score Template Links and tools%idFirst YCTNFHRDESRNPLTGKKLVPTSPIRKAWHKMCSGLast
1 -6.420sp|Q7Z4H7|HAUS6_HUMAN HAUS augmin-like complex subunit 6 OS=Homo sapiens GN=HAUS6 PE=1 SV=2  ali   36  10.........GSNPFLTRNQIPRTPIRSSWRK.... 37
2 -4.710sp|Q8NEZ4|MLL3_HUMAN Histone-lysine N-methyltransferase MLL3 OS=Homo sapiens GN=MLL3 PE=1 SV=3  ali   22  12FFPNIDFDAITDPIMKAKMVALKGINKVMAQNNLG 46
3 -4.270sp|Q14207|NPAT_HUMAN Protein NPAT OS=Homo sapiens GN=NPAT PE=1 SV=3  ali   21  1......QAVSPNFSQGSAIIIASPVQPVLQGMVG. 28
4 -4.180sp|Q9H6A9|PCX3_HUMAN Pecanex-like protein 3 OS=Homo sapiens GN=PCNXL3 PE=1 SV=2  ali   33  187.......STPLNPLLGSAVFIMSYARKFWER.... 212
5 -4.150sp|Q9UPR5|NAC2_HUMAN Sodium/calcium exchanger 2 OS=Homo sapiens GN=SLC8A2 PE=2 SV=2  ali   23........EQLVGIANYYALLHQQKSRAFYRIQA. 48
6 -4.120sp|Q9H7P9|PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens GN=PLEKHG2 PE=1 SV=3  ali   46  23......................SEIRSAWQALEQG 35
7 -3.660sp|Q7Z3E5|ARMC9_HUMAN LisH domain-containing protein ARMC9 OS=Homo sapiens GN=ARMC9 PE=2 SV=2  ali   38  19..ADLDKDELIQPLSGEKLLTTE............ 43
8 -3.470tr|B2RTR6|B2RTR6_HUMAN PCNX protein OS=Homo sapiens GN=PCNX PE=2 SV=1  ali   34  186.......STPLNPFLGSAIFITSYVRKFWE..... 210
9 -3.470sp|Q96RV3|PCX1_HUMAN Pecanex-like protein 1 OS=Homo sapiens GN=PCNX PE=2 SV=2  ali   34  186.......STPLNPFLGSAIFITSYVRKFWE..... 210
10 -3.420sp|O95785|WIZ_HUMAN Protein Wiz OS=Homo sapiens GN=WIZ PE=1 SV=2  ali   40  1...QVPRELSLTPITGAK................. 15

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.