Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF01402.21; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family, from PfamA32U

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst LISVHVPKKMLEELDELVRRGIFPNRSEAIRAALRDLLYKLast
1 -20.9002ca9_A mol:protein length:148 PUTATIVE NICKEL-RESPONSIVE REGULATOR  ali model follow..  30  13.FSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVE 51
2 -20.9001q5v_A mol:protein length:133 Nickel responsive regulator  ali model follow..  41  4.VTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQ 42
3 -20.9002wvb_A mol:protein length:148 PUTATIVE NICKEL-RESPONSIVE REGULATOR  ali model follow..  30  13.FSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVE 51
4 -20.8002bj1_A mol:protein length:138 NICKEL RESPONSIVE REGULATOR  ali model follow..  38  6.FSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIR 44
5 -20.7002wvc_A mol:protein length:148 PUTATIVE NICKEL-RESPONSIVE REGULATOR  ali model follow..  30  13.FSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVE 51
6 -16.2005ceg_A mol:protein length:93 Addiction module antidote protein, CopG/Arc/MetJ family  ali model follow..  35  7.MSVAVTPQQAAVMREAVEAGEYATASEIVREAVRDWLAK 45
7 -16.0003kxe_C mol:protein length:88 Antitoxin protein parD-1  ali model follow..  33  6.TSVVLGDHFQAFIDSQVADGRYGSASEVIRAGLRLLEEN 44
8 -12.6004me7_E mol:protein length:94 Antitoxin EndoAI  ali model follow..  26  11.MKISLPENLVAELDGVAMREK-RSRNELISQAVRAYVSE 48
9 -12.3002cpg_A mol:protein length:45 TRANSCRIPTIONAL REPRESSOR COPG  ali model follow..  21  5.LTITLSESVLENLEKMAREMGL-SKSAMISVALENYKKG 42
10 -11.5001b01_A mol:protein length:45 TRANSCRIPTIONAL REPRESSOR COPG  ali model follow..  21  5.LTITLSESVLENLEKMAREMGL-SKSAMISVALENYKKG 42
11 -9.6202jxg_A mol:protein length:45 Proline dehydrogenase  ali model follow..  17  5TLGVKLDDPTRERLKAAAQSID-RTPHWLIKQAIFNYLEK 43
12 -9.5702k9i_A mol:protein length:55 Uncharacterized protein ORF56  ali model follow..  21  12.LGVYIPQEWHDRLMEIAKEKN-LTLSDVCRLAIKEYLDN 49
13 -9.2002k5j_A mol:protein length:80 uncharacterized protein yiiF  ali model follow..  21  12.ILLDLSNEVIKQLDDLEVQRN-LPRADLLREAVDQYLIN 49
14 -9.1202ay0_A mol:protein length:58 Bifunctional putA protein  ali model follow..  15  5TMGVMLDDATRERIKSAATRID-RTPHWLIKQAIFSYLEQ 43
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Harder T, Kolodny R, Sitbon E, Li Z, Godzik A. Using an alignment of fragment strings for comparing protein structures. Bioinformatics. 2007 Jan 15;23(2):e219-24.