current user: public

If you have questions about the server, please let us know.

Query: PF03224.14; VATH_ORYSJ/2-323; V-ATPase subunit H, from PfamA32U

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst DHAELTTEQVLKRDIPWESYMANKLISGTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVFLNILRNISKEDTVEYVLALIDEMLAVNPKRAALFYDNSLSGEDIYDPFLRLLLKGNWFVQEKSCKILTQIISARPKMQNGIVPNGEASNSKSKLTSTQDVLRGLVDWLCSQLRNPTHPNCSVPTAMHCLATLLREQYVRALFVQADGVKLLIPLISPASTQQSIQLLYETCLCIWLLSFYDAAVDYLSTTRVMPRLVEVVKGSTKEKVVRVVIMSIRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGLLast
1 -49.8001ho8_A mol:protein length:480 VACUOLAR ATP SYNTHASE SUBUNIT H  ali model follow..  15  13THFNEIRSIIRSRSVAWDALARSEELSEIDASTAKALESILVKKNIGSGFKVNGKTLIPLIHLLSTSDNEDCKKSVQNLIAELLSSDKYGDDTVKFFQEDPKQLEQLFDVSLKGDFQTVLISGFNVVSLLVQNGLHNVKLVEKLLKNNNLINI-------------------LQNIEQMDTCYVCIRLLQELAVIPEYRDVIWLHEDSQLATRIVATNSNHLGIQLQYHSLLLIWLLTFNPVFANELVQKSDFLDLLKLVKITIKEKVSRLCISIILQCCSTRVKQQLLLLGNALPTVQSLSERKYSDEELRQDISNLKEIL 348
2 -24.8005xjg_A mol:protein length:506 Vacuolar protein 8  ali model follow..  12  92.........................IQVAACAALGNL-AVNNENKLLIVEMGG---LEPLINQMMG-DNVEVQCNAVGCITNLATRDDNKHKIA------TSGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDESPSSRVKCQATLALRNLASDTSYQLEIVRAGGLPHLVKLI----QSDSIPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTLRNLAASEKNRKEFFESGAVEKCKELALD--SPVSVQSEISACFAIL 394
3 -24.5003au3_A mol:protein length:344 Adenomatous polyposis coli protein  ali model follow..  57.........................QICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLC----SMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLRE-----------------VGSVKALMECALE-VKKESTLKSVLSALWNLSCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSNEDHRQILRENNCLQTLLQHLKSHS-LTIVSNACGTLWNLSANPKDQEALWDMGAVSMLKNLIHSK--HKMIAMGSAAALRNL 341
4 -24.1003nmz_A mol:protein length:458 APC variant protein  ali model follow..  10  158.........................QICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLC----SMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLRE-----------------VGSVKALMECALE-VKKESTLKSVLSALWNLSCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVS-NEDHRQILRENNCLQTLLQHLK-SHSLTIVSNACGTLWNLSANPKDQEALWDMGAVSMLKNLIHSK--HKMIAMGSAAALRNL 442
5 -23.8003sla_A mol:protein length:168 Catenin beta-1  ali model follow..  14  2.......................................................................................................................................................SNYQDDAELATRAIPELTKLLNDEDQV--VVNKAAVMVHQLSKKEASRHAIMRSPQM--VSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLG-SPVDSVLFYAITTLHNLLLQEGAKMAVRLAGGLQKMVALLNK--TNVKFLAITTDCLQIL 166
6 -23.6005zhx_A mol:protein length:487 Rap1 GTPase-GDP dissociation stimulator 1  ali model follow..  11  34.........................VLLQTGRALGNICYDSHSLQAQLINMG---VIPTLVKLLGICQNAALTEMCLVAFGNLAELESSKEQFA------STNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGPSNNHQLQLAGALAIANFARNDANCIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLK-SEMPPVQFKLLGTLRMLIDAQAEAAEQLNVKLVERLVEWCEAK-DHAGVMGESNRLLSAL 353
7 -23.1001xm9_A mol:protein length:457 plakophilin 1  ali model follow..  4..IPKAVQYLSSQDEK---------YQAIGAYYIQHTCFQDESAKQQVYQLGG---ICKLVDLLRS-PNQNVQQAAAGALRNLVFRSTTNKLETR-----RQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSSTDELKEELIADALPVLADRVIIPFSGWCDGNSN-----MSREVVDPEVFFNATGCLRNLSADAGRQTMRNYSGLIDSLMAYVQNCVAASDDKSVENCMCVLHNLSYNPKGSGWLYHSDAIRTYLNLMGKSKKDATLEACAGALQNLTASKGSQLIGLKEKGLPQIARLLQS--GNSDVVRSGASLLSNM 358
8 -23.1004v3o_A mol:protein length:289 YIII_M5_AII  ali model follow..  12  18.........................ELQSALRKLSQIASGGNEQIQAVIDAG---ALPALVQLLSS-PNEQILQEALWTLGNIASGGNEQIQAVI-----DAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVID------------------AGALPALVQLL--SSPNEQILQEALWTLGNIASGNEQIQAVIDAGALPALVQLL----SSPNEQILQEALWTLGNIA-GNEQIQAVIDAGALPALVQLLSSPN-EQILQEALWTLGNIASGNEQKQAVKEAGALEKLEQLQSH--ENEKIQKEAQEALEKL 281
9 -23.0005xgc_A mol:protein length:503 Rap1 GTPase-GDP dissociation stimulator 1  ali model follow..  10  50.........................VLLQTGRALGNICYDSHSLQAQLINMG---VIPTLVKLLGICQNAALTEMCLVAFGNLAELESSKEQFA------STNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGPSNNHQLQLAGALAIANFARNDANCIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLK-SEMPPVQFKLLGTLRMLIDAQAEEQLGKNVKLVERLVEWCEAK-DHAGVMGESNRLLSAL 369
10 -22.9003gq2_A mol:protein length:651 General vesicular transport factor p115  ali model follow..  12  30....................VASSTLLDDRRNAVRALKSLSKKYRLEV----GIQAMEHLIHVLQTRSDSEIIGYALDTLYNIISNDEEEEVEFTEIFIKQQENVTLLLSLLEEFDFHVRWPGVKLLTSLLKQLGPQVQQIIL----------------VSPMGVSRLMDLL--ADSREVIRNDGVLLLQALTRNGAIQKIVAFENAFERLLDIITEEGNSDGGIVVEDCLILLQNLL-NNSNQNFFKEGSYIQRMKPWFEVGDENQLVRVLVSPNNPPGATSSCQKAMFQCGLLQQLCTILMATGVPADILTETINTVSEV 340
11 -22.8004rzp_A mol:protein length:252 Engineered Protein OR366  ali model follow..  15  3.......................................................DLEKLVELLTH-DDSKTQQEAARDLAEIASGNASAIKQVI-----DAGALEKLVELLTHDDSKVQQEAARALANIASGNDEAIKQVID------------------AGALEKLVELLT--HDDSKVQQEAARALANIASNDEAIKQVIDAGALEKLVELL----THDDSKVQQEAARALANIA-NDEAIKQVIDAGALEKLVELLT-HDDSKVQQEAARALANIASNTSAIKQVIDAGALEKLQELLTH--DDSKVQQEAQRALENI 239
12 -22.8004v3q_A mol:protein length:247 YIII_M4_AII  ali model follow..  12  3.......................................................ELPQMVQQLNS-PDQQELQSALRKLSQIASGGDEQIQAVI-----DAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVI-------------------AGALPALVQLLSSPNEQ--ILQEALWTLGNIASGDEQIQAVIDAGALPALVQLL----SSPNEQILQEALWTLGNIA-GDEQIQAVIDAGALPALVQLLSSPN-EQILQEALWTLGNIASGNEQKQAVKEAGALEKLEQLQSH--ENEKIQKEAQEALEKL 239
13 -22.7004d4e_A mol:protein length:251 ARMADILLO REPEAT PROTEIN ARM00016  ali model follow..  11  7.......................................................ELPQMVQQLNS-PDQQELQSALRKLSQIASGGNEQIQKLI-----EAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQKLIE------------------AGALSPLVKLL--DDASEEVIKNAVAAIANIAANNEQIQKLIEAGALSPLVKLL----DDASEEVIKNAVAAIANIA-NNEQIQKLIEAGALSPLVKLLDDAS-EEVIKNAVAAIANIAANNEMKQKLEEAGALPALEKLQSH--ANEEVQKNAQAALEAF 243
14 -22.7003t7u_A mol:protein length:378 Adenomatous polyposis coli protein  ali model follow..  10  42.........................QICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLC----SMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLRE-----------------VGSVKALMECALE-VKKESTLKSVLSALWNLSCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVS-NEDHRQILRENNCLQTLLQHLK-SHSLTIVSNACGTLWNLSANPKDQEALWDMGAVSMLKNLIHSK--HKMIAMGSAAALRNL 326
15 -22.5005mfb_A mol:protein length:243 YIII(Dq)4CqI  ali model follow..  12  5.......................................................ELPQMVQQLNS-PDQQELQSALRKLSQIASGGNEQIQKLI-----EAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQKLIE------------------AGALSPLVKLLDDASEE--VIKNAVAAIANIAANNEQIQKLIEAGALSPLVKLL----DDASEEVIKNAVAAIANIA-NNEQIQKLIEAGALSPLVKLLDDAS-EEVIKNAVAAIANIAANNEQIQKLEEAGAEPALEKLQSS--PNEEVQKNAQAALEAL 241
16 -22.5005mfi_A mol:protein length:243 YIII(Dq.V2)4CqI  ali model follow..  12  5.......................................................ELPQMVQQLNS-PDQQELQSALRKLSQIASGGNEQIQKLI-----EAGALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQKLIE------------------AGALSPLVKLLDDASEE--VIQEAVWAIANIASNNEQIQKLIEAGALSPLVKLL----DDASEEVIQEAVWAIANIA-NNEQIQKLIEAGALSPLVKLLDDA-SEEVIQEAVWAIANIASNNEQIQKLEEAGAEPALEKLQSS--PNEEVQKNAQAALEAL 241
17 -22.4004hxt_A mol:protein length:252 De Novo Protein OR329  ali model follow..  17  4........................................................VEKLVKLLTS-TDSETQKEAARDLAEIASGPASAIKAIV-----DAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVD------------------AGGVEVLVKLL--TSTDSEVQKEAARALANIASPDEAIKAIVDAGGVEVLVKLL----TSTDSEVQKEAARALANIA-PDEAIKAIVDAGGVEVLVKLLT-STDSEVQKEAARALANIASPTSAIKAIVDAGGVEVLQKLLTS--TDSEVQKEAQRALENI 239
18 -22.2003tt9_A mol:protein length:233 Plakophilin-2  ali model follow..  15  2............................................................................................................................................................SNADMEMTLERAVSMLEADHMLPSRISAAATFIQHECQKSEARKRVNQLRGILKLLQLL----KVQNEDVQRAVCGALRNLVFDNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITGLLWNLSSNDKLKNLMITEALLTLTENIII................... 146
19 -22.1004d49_A mol:protein length:243 ARMADILLO REPEAT PROTEIN ARM00027  ali model follow..  12  5.......................................................ELPQMVQQLNS-PDQQELQSALRKLSQIASGGNEQIQKLI-----EAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQKLIE------------------AGALSPLVKLLDDASEE--VIKEAVWAIANIASNNEQIQKLIEAGALSPLVKLL----DDASEEVIKEAVWAIANIA-NNEQIQKLIEAGALSPLVKLLDDAS-EEVIKEAVWAIANIASNNEMKQKLEEAGALPALEKLQSH--ANEEVQKNAQAALEAF 241
20 -22.1005aei_A mol:protein length:286 DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII  ali model follow..  12  20.........................ELQSALRKLSQIASGGNEQIQAVIDAG---ALPALVQLLSS-PNEQILQEALWALSNIASGGNEQIQAVI-----DAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVID------------------AGALPALVQLL--SSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLL----SSPNEQILQEALWALSNIA-GNEQIQAVIDAGALPALVQLLS-SPNEQILQEALWALSNIASGNEQKQAVKEAGALEKLEQLQSH--ENEKIQKEAQEALEKL 283
21 -22.1004plr_A mol:protein length:289 Arm00008  ali model follow..  12  19.........................ELQSALRKLSQIASGGNEQIQAVIDAG---ALPALVQLLSS-PNEQILQEALWTLGNIASGGNEQIQAVI-----DAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVID------------------AGALPALVQLL--SSPNEQILQEALWTLGNIASGNEQIQAVIDAGALPALVQLL----SSPNEQILQEALWTLGNIA-GNEQIQAVIDAGALPALVQLLSSP-NEQILQEALWTLGNIASGNEQKQAVKEAGAEPALEQLQSS--PNEKIQKEAQEALEKI 282
22 -22.0005ewp_A mol:protein length:252 ARO (armadillo repeats only protein)  ali model follow..  10  2........................................................SKTIRKLLSFTSNDILRFDKAYDENDV----QEFVNLC--SSTCEIEKLEDRMHPWAADPKTIGALSATQLAILASKENEPHYKDAI----------------REANGIAVFINLLKSHELD--RVHAAVVALSFLSDNVKNCICMFESGALPYLISGM----KSNIDGMKAACAQTCRNIFVDKKYKKEFLKLGGITQLVNLLELPSNYYTQLEAIYHLEDFILNDEFLEAVKNSNSIKNLKTLQQC--PEQDLAEASNVLLLRL 250
23 -21.9004v3r_A mol:protein length:286 YIII_M5_AII  ali model follow..  13  20.........................ELQSALRKLSQIASGGDEQIQAVIDAG---ALPALVQLLSS-PNEQILQEALWTLGNIASGGDEQIQAVI-----DAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVID------------------AGALPALVQLLS--SPNEQILQEALWTLGNIASGDEQIQAVIDAGALPALVQLL----SSPNEQILQEALWTLGNIA-GDEQIQAVIDAGALPALVQLLS-SPNEQILQEALWTLGNIASGNEQKQAVKEAGALEKLEQLQSH--ENEKIQKEAQEALEKL 283
24 -21.8004r0z_A mol:protein length:629 Protein humpback-2  ali model follow..  41.....................HDESVVARAVHRAYMLSREDPNFFNAPGFDHRSFV-EALMAASKS-SNVNVRRNAIGALSHMSEQRGGPLLIF------RSGGLAEIIRMLYDSLESVVHYAVTTLRNLLMHVSDSRAQVADGLYFLLIDDAPSKITFLSLLGPQILVSILREYSDHRKLIYTVVRCIRSLSVCPSNKPALISLGCLPALYVELC---TAKDERSQTAILVAMRNLS--DSATNEENLTQLIIKLLEIIR-VANDGMTACACGTLSNLTNNTRNKQTVCSHGGIDALVTAIRRLPEVEEVTEPALCALRHC 352
25 -21.7004b8j_A mol:protein length:528 IMPORTIN SUBUNIT ALPHA-1A  ali model follow..  13  74ESLPAMIGGVYSDD------------NNLQLEATTQFRKLLSIERSPPIEE-QSGVVPRFVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVI-----DHGAVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKCRDLVLANTLSNFCRGKPQPSFEQTRPALPALARLIH--SNDEEVLTDACWALSYLSDGTNDKQAVIEAGVCPRLVELL----LHPSPSVLIPALRTVGNIV-DDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITANKDQIQAVINAGIIGPLVNLLQT--AEFDIKKEAAWAISNA 398
26 -21.7004db8_A mol:protein length:252 Armadillo-repeat Protein  ali model follow..  12  7.......................................................ELPQMTQQLNS-DDMQEQLSATRKFSQILSDGNEQIQAVI-----DAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVID------------------AGALPALVQLLSSPNEQ--ILQEALWALSNIASGNEQIQAVIDAGALPALVQLL----SSPNEQILQEALWALSNIA-GNEQIQAVIDAGALPALVQLLSSP-NEQILQEALWALSNIASGNEQKQAVKEAGALEKLEQLQSH--ENEKIQKEAQEALEKL 243
27 -21.6003c2g_A mol:protein length:619 Sys-1 protein  ali model follow..  11  2NITQAAEQAIRL----WRTWIRQDKFAQVDQQILNIIYDGLKPQPVQLPISYYAQLWYNLLDILRRFTFLPIISPYIHQVVQMFCPRENGPQDFRELHLKFEKLVGTLSEYFNPHPGMINPAIFIIFRFIISKDTRLKDYFIWNNNPHDQPPPPTGLIIKLNAVMIGSYRLIAGQNPETLPQNPTFDLLGLLLHDSDAIDGFVRSDGVGAITTVV----QYPNNDLIRAGCKLLLQVS-DAKALAKTPLENILPFLLRLIEIHPDDEVIYSGTGFLSNVVHKQHVKDIAIRSNAIFLLHTIISKRNRVCEIICNCLRTLNNF 408
28 -21.4001jpw_A mol:protein length:540 BETA-CATENIN  ali model follow..  10  163.........................FLAITTDCLQILAYGNQESKLIILASGG---PQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIV------EAGGMQALGLHLTDPSQRLVQNCLWTLRNLSSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSCPANHAPLREQGAIPRLVQLLVRAHGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLY-SPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHS--RNEGVATYAAAVLFRM 532
29 -21.4005t94_B mol:protein length:542 Importin subunit alpha  ali model follow..  13  147.........................LQLEAAWALTNIASGTSAQTKVVVDAD---AVPLFIQLLYT-GSVEVKEQAIWALGNVAGDSTDYRDYVL-----QCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSV------------------VSQALPTLAKLIY--SMDTETLVDACWAISYLSDPQEAIQAVIDVRIPKRLVELL----SHESTLVQTPALRAVGNIV-NDLQTQVVINAGVLPALRLLLS-SPKENIKKEACWTISNITANTEQIQAVIDANLIPPLVKLLEV--AEYKTKKEACWAISNA 410
30 -21.3005mfd_A mol:protein length:328 YIIIM``6AII  ali model follow..  13  62.........................ILQEALWTLGNIASGGNEQIQAVIDAG---ALPALVQLLSS-PNEQILQEALWTLGNIASGGNEQIQAVI-----DAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVID------------------AGALPALVQLLSSPNEQ--ILQEALWTLGNIASGNEQIQAVIDAGALPALVQLL----SSPNEQILQEALWTLGNIA-GNEQIQAVIDAGALPALVQLLS-SPNEQILQEALWTLGNIASGNEQKQAVKEAGALEKLEQLQSH--ENEKIQKEAQEALEKL 325
31 -21.3002yns_A mol:protein length:490 IMPORTIN SUBUNIT ALPHA-1A  ali model follow..  12  36SSLPAMIGGVYSDDNN---------LQLEATTQFRKLLSIERSPPIEEVIQSG--VVPRFVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVI-----DHGAVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKCRDLVATWTLSNFCRGKPQPSFEQTRPALPALARLIH--SNDEEVLTDACWALSYLSDTNDKIQAVIEAGVCPRLVELL----LHPSPSVLIPALRTVGNIV-DDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITANKDQIQAVINAGIIGPLVNLLQT--AEFDIKKEAAWAISNA 360
32 -21.1004rxh_B mol:protein length:495 Importin subunit alpha  ali model follow..  11  123.........................VREQAVWALGNIAGDSPQCRDYVLSCG---ALRPLLTLLGDSRKLSMLRNATWTLSNFCRGKTPQPDWNT-----IAPALPVLAKLVYSLDDEVLIDACWAISYLSDGSNDKIQAVIE------------------AGIPRRLVELLMHASTS--VQTPALRSVGNIVTDDVQTQVIINCGALPCLLSLL----SSNKDGIRKEACWTISNIT-NSAQIQSVIDANIIPPLIHLLSHA-DLKTRKEACWAISNATQKPDQIRYLVAQGCIKPLCDLLAC--PDNKIIQVALDGLENI 390
33 -21.1005mfm_C mol:protein length:350 Importin subunit alpha  ali model follow..  13  62.........................ILQEALWALSNIASGGNEQIQAVIDAG---ALPALVQLLSS-PNEQILQEALWALSNIASGGNEQIQAVI-----DAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVID------------------AGALPALVQLLSSPNEQ--ILQEALWALSNIASGNEQIQAVIDAGALPALVQLL----SSPNEQILQEALWALSNIA-GNEQIQAVIDAGALPALVQLLS-SPNEQILQEALWALSNIASGNEQKQAVKEAGALEKLEQLQSH--ENEKIQKEAQEALEKL 325
34 -20.9003tpo_A mol:protein length:529 Importin subunit alpha-2  ali model follow..  14  92.........................SQLQATQAARKLLSREKQPPIDNIIRAG--LIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVV-----DGGAIPAFISLLASPHAHISEQAVWALGNIAGAGSAFRDLVI-------------------HGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLT-PNERIEMVVKKGVVPQLVKLLG-ATELPIVTPALRAIGNIVTTDEQTQKVIDAGALAVFPSLLTN--PKTNIQKEATWTMSNI 362
35 -20.8004uad_A mol:protein length:479 Importin subunit alpha-7  ali model follow..  13  39.........................LQLATTQKFRKLLSKEPSPPIDEVINTPR-VVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVI-----EAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSSVCRDYVLN------------------CSILNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLL----FSSDSDLLADACWALSYLS-PNEKIQAVIDSGVCRRLVELLM-HNDYKVASPALRAVGNIVTDDIQTQVILNCSALPCLLHLLSS--PKESIRKEACWTISNI 306
36 -20.8005mfl_A mol:protein length:350 (KR)5_GS10_YIIIM6AII  ali model follow..  12  84.........................ILQEALWALSNIASGGNEQIQAVIDAG---ALPALVQLLSS-PNEQILQEALWALSNIASGGNEQIQAVI-----DAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVID------------------AGALPALVQLL--SSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLL----SSPNEQILQEALWALSNIA-GNEQIQAVIDAGALPALVQLLSSP-NEQILQEALWALSNIASGNEQKQAVKEAGALEKLEQLQSH--ENEKIQKEAQEALEKL 347
37 -20.8004db6_A mol:protein length:210 Armadillo repeat protein  ali model follow..  12  4....................................................................................................SGSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVI-------------------AGALPALVQLL--SSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLL----SSPNEQILQEALWALSNIA-GNEQIQAVIDAGALPALVQLLSSPN-EQILQEALWALSNIASGNEQKQAVKEAGALEKLEQLQSH--ENEKIQKEAQEALEKL 201
38 -20.7003l6x_A mol:protein length:584 Catenin delta-1  ali model follow..  10  92..IPVLVGLLDHPKKE---------VHLGACGALKNISFGRDQDNKIAIKNCD---VPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEI-------VDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSSPARGYELLFQPEVVRIYISLLK---ESKTPAILEASAGAIQNLC-GRYIRSALRQEKALSAIADLLT-NEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSEDTVISILNTINEV 430
39 -20.7003ifq_A mol:protein length:553 plakoglobin  ali model follow..  11  157.....................NNPKFLAITTDCLQLLAYGNQESKLIILANGG---PQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIV------EAGGMQALGKHLTSNSPRLVQNCLWTLRNLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSCPANHAPLQEAAVIPRLVQLLVKAHQDRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLY-SSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHS--RNEGTATYAAAVLFRI 529
40 -20.6004dba_A mol:protein length:210 Designed Armadillo repeat protein, YIIM3AII  ali model follow..  13  4....................................................................................................SGSELPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVI-------------------AGALPALVQLL--SSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLL----SSPNEQILQEALWALSNIA-GNEQIQAVIDAGALPALVQLLS-SPNEQILQEALWALSNIASGNEQKQAVKEAGALEKLEQLQSH--ENEKIQKEAQEALEKL 201
41 -20.6004tnm_A mol:protein length:531 Importin subunit alpha  ali model follow..  12  75DNLPAMVAGIWSED------------SNSQLEATNLLRKLLSIEQNPPINE-QSGVVPRVVKFLSRDDFPKLQFEAAWALTNIASGTSENTNVII-----ESGAVPIFIQLLSSASEDVREQAVWALGNVAGDSPKCRDLVLSYTLSNFCRGKPPPAFEQTQPALPVLERLVQ--SMDEEVLTDACWALSYLSDNSNDKQAVIEAGVVPRLIQLL----GHSSPSVLIPALRTIGNIV-DDLQTQMVLDQQALPCLLNLLKNNYKKSIKKEACWTISNITANADQIQAVIDAGIIQSLVWVLQS--AEFEVKKEAAWGISNA 399
42 -20.6004db9_A mol:protein length:210 Armadillo repeat protein, YIIIM3AIII  ali model follow..  12  4....................................................................................................SGSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVI-------------------AGALPALVQLL--SSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLL----SSPNEQILQEALWALSNIA-GNEQIQAVIDAGALPALVQLLSSP-NEQILQEALWALSNIASGNEQKQAVKEAGAEPALEQLQSS--PNEKIQKEAQEALEKI 201
43 -20.5004rv1_A mol:protein length:420 Engineered Protein OR497  ali model follow..  16  144.........................VQKEAARALANIASGPDEAIKAIVDAGG---VEVLVKLLTS-TDSEVQKEAARALANIASGPTSAIKAIV-----DAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVD------------------AGGVEVLVKLL--TSTDSEVQKEAARALANIASPDEAIKAIVDAGGVEVLVKLLT----STDSEVQKEAARALANIA-PDEAIKAIVDAGGVEVLVKLLT-STDSEVQKEAARALANIASPTSAIKAIVDAGGVEVLQKLLTS--TDSEVQKEAQRALENI 407
44 -20.1004e4v_A mol:protein length:485 Importin subunit alpha-2  ali model follow..  14  43.........................NQLQATQAARKLLSREKQPPIDNIIRAG--LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV-----DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIK------------------YGAVDPLLALLAVPDMSSGYLRNLTWTLSNLCRNKNPAPIDAVEQILPTLVRLL----HHDDPEVLADTCWAISYLT-PNERIGMVVKTGVVPQLVKLLG-ASELPIVTPALRAIGNIVTTDEQTQVVIDAGALAVFPSLLTN--PKTNIQKEATWTMSNI 313
45 -20.1005tbk_A mol:protein length:521 Importin subunit alpha-3  ali model follow..  10  173.........................VCEQAVWALGNIIGDGPQCRDYVISLG---VVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETI-----QEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVI-------------------SGIVPHLVPLL--SHQEVKVQTAALRAVGNIVTTDEQTQVVLNCDALSHFPALL----THPKEKINKEAVWFLSNIT-NQQQVQAVIDANLVPMIIHLLDKG-DFGTQKEAAWAISNLTIRKDQVAYLIQQNVIPPFCNLLTV--KDAQVVQVVLDGLSNI 438
46 -19.9002z6h_A mol:protein length:644 Catenin beta-1  ali model follow..  12  156.........................FLAITTDCLQILAYGNQESKLIILASGG---PQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWP-LIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLY-SPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSR--NEGVATYAAAVLFRM 525
47 -19.8003now_A mol:protein length:810 UNC-45 protein, SD10334p  ali model follow..  10  398...............................WAADGLAYLTLDAECKEKLIEDKASIHALMDLARG-GNQSCLYGVVTTFVNLCNAYEKQEMLFAKQHIPEEHELDDVDFINKRITVLANEGITTALCALAKTESHNSQELIARVLNAVCGLKELRGKVVQEGGVKALLRMALEGTEK--GKRHATQALARIGITINPEVSFSGQRSLDVIRPLLNLLQQDCTALENFESLMALTNLSMNESVRQRIIKEQGVSKIEYYLM-EDHLYLTRAAAQCLCNLVMSEDVIKMFENNDRVKFLALLCED--EDEETATACAGALAII 692
48 -19.7002jdq_A mol:protein length:450 IMPORTIN ALPHA-1 SUBUNIT  ali model follow..  10  123.........................VQEQAVWALGNIAGDSTMCRDYVLDCN---ILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAK-----VSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVID------------------AGVCRRLVELL--MHNDYKVVSPALRAVGNIVTDDIQTQVILNCSALQSLLHLL----SSPKESIKKEACWTISNIT-NRAQIQTVIDANIFPALISILQTA-EFRTRKEAAWAITNATSSAEQIKYLVELGCIKPLCDLLTV--MDSKIVQVALNGLENI 388
49 -19.7003fex_C mol:protein length:467 Importin subunit alpha-2  ali model follow..  14  10..VDDIVKGINSSNVE---------NQLQATQAARKLLSREKQPPIDNIIRAG--LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV-----DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIK------------------YGAVDPLLALLAVPDMSSGYLRNLTWTLSNLCRKNPAPPIDAVEQILPTLVRLL----HHDDPEVLADTCWAISYLT-PNERIGMVVKTGVVPQLVKLLGASE-LPIVTPALRAIGNIVTTDEQTQVVIDAGALAVFPSLLTN--PKTNIQKEATWTMSNI 294
50 -19.4004wv6_A mol:protein length:471 Importin subunit alpha-1  ali model follow..  13  20..VDDIVKGINSSNVE---------NQLQATQAARKLLSREKQPPIDNIIRAG--LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVV-----DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIK------------------YGAVDPLLALLAVPDMSSGYLRNLTWTLSNLCRKNPAPPIDAVEQILPTLVRLL----HHDDPEVLADTCWAISYLT-PNERIGMVVKTGVVPQLVKLLG-ASELPIVTPALRAIGNIVTTDEQTQVVIDAGALAVFPSLLTN--PKTNIQKEATWTMSNI 304
51 -19.3003oqs_A mol:protein length:510 Importin subunit alpha-2  ali model follow..  53..VEDIVKGINSNNLE---------SQLQATQAARKLLSREKQPPIDNIIRAG--LIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVV-----DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHLSNLCRNKNPAPPLDAVEQILPTLVRLLH--HNDPEVLADSCWAISYLTDPNERIEMVVKKGVVPQLVKLL----GATELPIVTPALRAIGNIV-TDEQTQKVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITARQDQIQQVVNHGLVPFLVGVLSK--ADFKTQKEAAWAITNY 379
52 -19.2005ctt_A mol:protein length:447 Importin subunit alpha-1  ali model follow..  36.........................SQLQATQAARKLLSREKQPPIDNIIRAG--LIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVV-----DGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPE--VLADSCWAISYLTDGPNEREMVVKKGVVPQLVKLL----GATELPIVTPALRAIGNIV-TDEQTQKVIDAGALAVFPSLLT-NPKTNIQKEATWTMSNITARQDQIQQVVNHGLVPFLVGVLSK--ADFKTQKEAAWAITNY 348
53 -19.2001xqr_A mol:protein length:296 HspBP1 protein  ali model follow..  13  10...............................RGSHMRGQRGEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFC-----QLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLG------------------LGALRKLLRLLDR-DACDTVRVKALFAISCLVRQEAGLLQFLRLDGFSVLMRAM----QQQVQKLKVKSAFLLQNLL-HPEHKGTLCSMGMVQQLVALVR-TEHSPFHEHVLGALCSLVTDFPQGVRECREGLEELLRHRCQLLQQHEEYQEELEFCEKLL 276
54 -19.2004cb9_A mol:protein length:571 BETA-CATENIN-LIKE PROTEIN 1  ali model follow..  12  92EKRSYKNQELRIKFPD-EKFMESELDLNDIIQEMHVVATMPDLYHLLV----ELNAVQSLLGLLGH-DNTDVSIAVVDLLQELTDIDTLHES--LIDALVDGQVVALLVQNLVKEEADGVHNTLAIVENMAEFRPEMCTEGAQ------------------QGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQNDENRELLGELDGIDVLLQQLSNPSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLREKKISR--SSALKVLDHAMIGTDNCHKFVDILGLRTIFPLFMKS-TEKEHEEHVCSILASL 416
55 -18.9002z6g_A mol:protein length:780 B-catenin  ali model follow..  13  162.....................EDQVVVNKAAVMVHQLSKKEASRHAIMRSPQM---VSAIVRTMQNTNDVETARCTSGTLHNLSHHREGLLAIF------KSGGIPALVNMLGSPVDSVLFHAITTLHNLLLHQEGAKMATTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYE-KLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT----DPSQRLVQNCLWTLRNLS--DAATKQEGMEGLLGTLVQLLG-SDDINVVTCAAGILSNLTNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHL 470
56 -18.7005ufl_A mol:protein length:561 Protein CIP2A  ali model follow..  11  3....DSTACLKSLLLTVSQYKAVK--SEANATQLRHLEVISGQKLTRLFTSNQILTSECLSCLVDPNISASLILSIIGLLSQLAVDIETRDCLQ-----NTYNLNSVLAGVVSSHTDSVFLQCIQLLQKLTYN------------------VKIFYSGANIDELITFLIDHI--QSSEDELKMPCLGLLANLCHNLSVQTHIKTLSNVKSFYRTLITLLAHSSLTVVVFALSILSSLTLNEEVGEKLFHAQTFQLIFNILINGDGTLTRKYSVDLLMDLLKNPKIADYLTRYECLHQVLGLLNGK--DPDSSSKVLELLLAF 307
57 -17.8004u2x_D mol:protein length:175 Importin subunit alpha-6  ali model follow..  11  7.................................................................................................................................................................CSALPCLLHLL--SSPKESIRKEACWTVSNITANRAQIQAVIDANIFPVLIEIL----QKAEFRTRKEAAWAITNAT-TPEQIRYLVALGCIKPLCDLLT-VMDSKIVQVALNGLENILRLGEQESKIEEAYGLDKIEFLQSH--ENQEIYQKAFDLIEHY 173
58 -16.4003opb_A mol:protein length:778 SWI5-dependent HO expression protein 4  ali model follow..  10  287...ETMRTYITENYLQL-----ERSLNVEDVQIYSALVLVKTWSFTKLTCINLKQLSEIFINAISR-RIVPKVEMSVEALAYLSLKASVKIMI-----RSNESFTEILLTMIKSQMTHCLYGLLVIMANLSTLPEEXXXXXXXXXXXXXXXXXXXPAADKVGELISFLKREMHNLSPN--CKQQVVRIIYNITRSKNFIPQLAQQGAVKIILEYLAN-KQDIGEPIRILGCRALTRMLIFTN--KKYSALNAIPFLFELLPRSTPVDDNPLALLALTNLASSETSKHIVSTKVYWSTIENLMLD--ENVPLQRSTLELISNM 633
59 -16.0004cb8_A mol:protein length:496 BETA-CATENIN-LIKE PROTEIN 1  ali model follow..  12  22...KNQELRIKFPDNP-EKFMESELDLNDIIQEMHVVATMPDLYHLLV----ELNAVQSLLGLLGH-DNTDVSIAVVDLLQELTDIDTLHES-VLIDALVDGQVVALLVQNLEREEADGVHNTLAIVENMAEFRPEMCTEGAQ------------------QGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQNDENRELLGELDGIDVLLQQLSV-STAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLREKKISR--SSALKVLDHAMIGTDNCHKFVDILGLRTIFPLFKVGTTEKEHEEHVCSILASL 341
60 -15.5004gmo_A mol:protein length:684 Putative uncharacterized protein  ali model follow..  11  27...............................................................................................ELAKLREDKILPVLKDLKSPDAKSRTTAAGAIANIVQDAKCRKLLLR-------------------EQVVHIVLTETLT-DNNIDSRAAGWEILKVLAQEEEADVHLYRLDVLTAIEHAAKAVLERLVWDITGSLLVLIGLLA-RDEIHEAVATKQTILRLLFRLISADIQDIYEEAISCLTTLSENLKVGQAITDDQETHVYDVLLKLATGTDPRAVMACGVLHNV 256
61 -14.8004l7m_A mol:protein length:269 Putative uncharacterized protein  ali model follow..  12  1.......................GAMGMSEKTELRELVLSWQILDAVSLALEDKRALFLILELAGE-DDETTRLRAFVALGEILKRADSDLRMMVL-----ERHLDVFINALSQENEKVTIKALRALGYLVKDVPMGSKT--------------------FLKAAKTLVSLL--ESPDDMMRIETIDVLSKLQPLEDSKL----------VRTYINELVVSPDLYTKVAGFCLFLNMLNSSADSGHLTL--ILDEIPSLLQN-DNEFIVELALDVLEKALSFPLLENVKIELKISRIVDGLVYRE-GAPIIRLKAKKVSDLI 263
62 -12.9004i2w_A mol:protein length:961 Protein UNC-45  ali model follow..  11  550................................ACEGLSYLSLDADVKEWIVDDSLLLKALVLLA-KKAGALCVYTLATIYANLSDEEMVKLAQFAKHHVPETHPKDTEEYVEKRVRALVEEGAVPACVAVSKTESKNALELIARSLLAFAEYEDLRGRIIAEGGTVLCLRLTKEASGEGKIK--AGHAIAKLGAKADPMISFPGQRAYEVVKPLCDLLHPDVEGKANYDSLLTLTNLSVSDSIRGRILKEKAIPKIEEFWFMTDHEHLRAAAAELLLNLLFFEKFYEETVAPGTDRLLWVLYSAEVEEERLSRASAAGFAIL 846
63 -12.7003ebb_A mol:protein length:304 PHOSPHOLIPASE A2-ACTIVATING PROTEIN  ali model follow..  54...............................................................................ILGKLKELNGTAPEEKKLTEDDLILLEKILSLICNSSSEKPTVQQLQILWKAINCPEDIVFPALDILRLSIKHPSVNENEKEGAQFSSHLINLLNPKGKPANQLLALRTFCNCFVGQAGQKLMMSQ--RESLMSHAIELKSGSNKNIHIALATLALNYSV-HKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL 298
64 -12.5004d4z_A mol:protein length:294 DEOXYHYPUSINE HYDROXYLASE  ali model follow..  10  28.........................ARFRALFTLRGLGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPAAGPYLSVDPAPPAEERD------VGRLREALLDESRPLFERYRAMFALRNA--------------GGEEAALALAEGLHCGSALFRHEVGYVL----------GQLQHEAAVPQLAAALARCTENPMVRECAEALGAIARPA----------CLAALQAHADD--PERVVRESCEVALDMY 285
65 -12.5005n3u_B mol:protein length:208 Phycocyanobilin lyase subunit beta  ali model follow..  10  1.......................................................MTNELINGVALADTPEKLVKAVQELALA----------------KDVAAIPTLIAVFGYNNPTAAAIASTALVQL-------------------------------EVAVPQLLTQI--DDYNYGARAYSIRTLAAI-------------ADPRALDVLIDAAATDFAPSVRRAAAKGLGNLHWHKFPDNQTAPKKALETLLFISQD-AEWSIRYAAIVGLQGLVNIPDLQQPIHTR--------LKEMLASDAEVRARILLAQSQL 201
66 -12.0005k7v_A mol:protein length:288 Designed protein HR00C3  ali model follow..  21..IEELARAADNKTTEKAVAEAIEEIARLATAAIQLIEALAKNLASEAIAELAKKAIEAIYRLADNHTTDTFMARAIAAIANLAVTAILAIAAL----------------ASNHTTEEFMARAISAIAEL---AKKAIEAIYRLADNHTTDKFMAAAIEAIALLATLAILAIALLASNHTTEEFMAKAISAIAELAK--------KAIEAIYRLA------DNHTSPTYIEKAIEAIE---------IARKAIKAIEMLAKNITTEEYKEKAKSAIDEIREKAK--------EAIKRLEDNRTLE................. 282
67 -11.6005xah_A mol:protein length:416 Importin-4  ali model follow..  12  39KLLECPHLNVRKAAH--------EALGQFCCALHKACQSCPSEPNTAALQAALARVVPSYMQAVNRERERQVVMAVLEALTGVLRSCGTLTLKPPGRLAELCGVLKAVLQ-QAEYDAMLLEHAGEAIPALAQGCTVAEKSFAVGTLAETIQGLGAASAQFVSRLLPVLLSTA--QEADPEVRSNAIFGMGVLAEHGGHPAQ-------KLLGLLFPLLARERHDRVRDNICGALARLL--MASPTRKPEPQVLAALLHALPLKEDLEEWVTIGRLFSFLYQSSPDQVIDVAPELLRICSLILADNKIPPDTKAALLLLLTFL 386
68 -10.7004lac_A mol:protein length:258 PP2A Scaffold Subunit A, Truncated, an internal deletion of PP2A A  ali model follow..  13  1......................STGIASDSSSDSSSSSSSSSSDSDSECESMSLYPIAVLIDELRN-EDVQLRLNSIKKLSTIAL--------ALGVERTRSELLPFIVELAEDAKWRVRLAIIEYMPLLA---------------------GQLGVEYFDEKLNSLCMAWLV--DHVYAIREAATSNLKKLVE------KFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLS--EVCGQDITTKHMLPTVLRMAGDPV--NVRFNVAKSLQKIG--PILDNSTLQSEVKPILEKLT----QDQDAQEALTVLSLA. 258
69 -10.5003qml_C mol:protein length:315 Nucleotide exchange factor SIL1  ali model follow..  21.............................................................................................................................................................SSDFKEMRNIIDSNPTLSSQDIARLEDSFDRIMEFAHDYKHGYKIITHEF---ALLANLSLNENLPLTLRELSTRVI-CLRNNPPVVEFINESNFKSKIMAALSNLNDSNHRSILIKRYLSILNELPVTSEDLPIYSTVVLQNVYERNNKDKQLQIKVLELISKI 187
70 -10.5002db0_A mol:protein length:253 253aa long hypothetical protein  ali model follow..  2........................SMEEEEFDIREALANGEHLEKILIMAKYDESVLKKLIELLDD-DLWTVVKNAISIIMVIAKTREDLY----------EPMLKKLFSLLKKSEA-LTQEIAKAFGQMAKEKPE-----------------------LVKSMIPVLFANY--RIGDEKTKINVSYALEEIAKANP--------MLMASIVRDFMSMLSSKNREDKLTALNFIEAMGENSFKYVN----PFLPRIINLLHD-GDEIVRASAVEALVHLATLNDKLRKVV----IKRLEELND---TSSLVNKTVKEGISRL 244
71 -10.1005a7d_L mol:protein length:341 INSCUTEABLE  ali model follow..  11  41...PEVMCTLQHKSIAQEAYKNYTITTSAVCKLVRQL-----QQQALSLQVHFERSERVLSGLQASSEALAGATQLLSHLDDFTATLERRGVFFNDAKIERRRYEQHLEQIRTVSKD---------TRYSLERQHYINLESLLDDVQLLKRHTLITLRLIFERLVRVLVISIEQSQCDLLLR-ANINMVATLMNIRSLSDAFVQNEAVRTLLVVVLDHKQS---SVRALALRALATLCCAPQAINQLGSCGGIEIVRDILQVESAGEERREAVSLLAQITASEHRVPGLRDESLVAGLAALLQPE................. 341
72 -10.0004a0c_A mol:protein length:1253 CULLIN-ASSOCIATED NEDD8-DISSOCIATED PROTEIN 1  ali model follow..  12  1.........................MASWSHPQFEKVDENLYFQGGGRMASASYHISNLLEKM--TSSDKDFRFMATNDLMTELQKDSIKLD-----DDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELIAKQEDVSVQLEALDIMADMLSRQGG------VNFHPSILTCLLPQLTSPRLAVRKRTIIALGHLV---MSCGNIVFVDLIEHLLSELSKNDSMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNV--DDDELREYCIQAFESF 305
73 -9.8605ife_C mol:protein length:1304 Splicing factor 3B subunit 1  ali model follow..  10  980EYLGEEYPEVLGSILG--NVIGMHKMTPPIKDLLPRLTPILKNRHEK-VQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYHDVLATLLNNLKVQERQNRVCTTVAIAIVYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALM--DRDLVHRQTASAVVQHMSLGVYGFGC---EDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLR------VAIGPCRMLQYCLQGLFHPA-RKVRDVYWKIYNSIYI-------GSQDALIAHYPRIY-NDDKNTYIRYELDYI.... 1303
74 -9.8206epc_N mol:protein length:953 26S proteasome non-ATPase regulatory subunit 1  ali model follow..  464QLKNASNDIVRHGGSLGLGLAAMGTARQDVYDLLKTNLYQDDAVTGEMLGSKNTQAIEDMVGYAQETQHEKILRGLAVGIALVMYGRMEEADALIES-------------LCRDKDPILRRSGMYTVAMAYCGSGN---------------------NKAIRRLLHVAVS-----DVNDDVRRAAVESLGFILFRTP-----------EQCPSVVSLLSESYNPHVRYGAAMALGVCCAGTG------NKEAINLLEPMTND-PVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGIL 737
75 -9.7406IE1 Entity 1(prereleased)  ali follow..  14  97..............................................................................................................................................................................QSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQPMVDSILQRSLAILESMVLNSQSLYQKIAEEI--TVGQLISHQVSNQEIQTYAIALINAL 246

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.