current user: public

If you have questions about the server, please let us know.

Query: PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like, from PfamA32U

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst SPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKEYKEVILKLLIIFENINDNFKWEENEPAQNHFSEGSLFFFLKEFQVCADKVLGIESRHDFQVRVKVGLast
1 -41.6005xjg_A mol:protein length:506 Vacuolar protein 8  ali model follow..  15  27EDKDQLDFYSGGPLKALTTLV-YSDNLNLQRSAALAFAEIT---EKYVRQVSREVLEPILILLQSQDPQIQVAACAALGNLAVNNENKLLIVEMGGLEPLINQMMGDNVEVQCNAVGCITNLATRDDNKHKISGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENRKELVNAGAVPVLVSLLSST-DPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCLVKLIQSDSIPLVLASV 304
2 -40.3004d4e_A mol:protein length:251 ARMADILLO REPEAT PROTEIN ARM00016  ali model follow..  17  2.......RGSGSELPQMVQQL-NSPDQQELQSALRKLSQIASGNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAANNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQKAGALSPLVKLLDDASEEVIKNAVAAIANIAANNEQIQKLIEAGALSPLVKLLDDASEE-VIKNAVAAIANIAAGNNEMKQKLE---------------EAGALPALEKLQSHANEEVQKNAQ 237
3 -39.7004rzp_A mol:protein length:252 Engineered Protein OR366  ali model follow..  17  2...........NDLEKLVELL-THDDSKTQQEAARDLAEIASNASAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASNDEAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGNDEAIKQAGALEKLVELLTHDDSKVQQEAARALANIASNDEAIKQVIDAGALEKLVELLTHD-DSKVQQEAARALANIASG-NTSAIKQVIDAGALEKLQELLTHDDSKVQQLENIKSGGWLE...... 246
4 -39.1005mfi_A mol:protein length:243 YIII(Dq.V2)4CqI  ali model follow..  17  2.........PGSELPQMVQQL-NSPDQQELQSALRKLSQIASGGNEQQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQKAGALSPLVKLLDDASEEVIQEAVWAIANIASNNEQIQKLIEAGALSPLVKLLDDASEE-VIQEAVWAIANIASGNNEQIQKLE---------------EAGAEPALEKLQSSPNEEVQKNAQ 235
5 -39.1004db8_A mol:protein length:252 Armadillo-repeat Protein  ali model follow..  16  2.......RGSGSELPQMTQQL-NSDDMQEQLSATRKFSQILSGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAAGALPALVQLLSSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLLSSPNEQ-ILQEALWALSNIASGGNEQKQAVK---------------EAGALEKLEQLQSHENEKIQKEAQ 237
6 -39.0004v3o_A mol:protein length:289 YIII_M5_AII  ali model follow..  18  33GNEQIQAVIDAGALPALVQLL-SSPNEQILQEALWTLGNIASGGNEQQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAAGALPALVQLLSSPNEQILQEALWTLGNIASGNEQIQAVIDAGALPALVQLLSSPNEQ-ILQEALWTLGNIASGGNEQKQAVK---------------EAGALEKLEQLQSHENEKIQKEAQ 275
7 -38.9005mfb_A mol:protein length:243 YIII(Dq)4CqI  ali model follow..  17  2.........PGSELPQMVQQL-NSPDQQELQSALRKLSQIASGNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAANNEQIQKLIEAGALSPLVKLLDDASEEVIKNAVAAIANIAAGNNEQIQKAGALSPLVKLLDDASEEVIKNAVAAIANIAANNEQIQKLIEAGALSPLVKLLDDA-SEEVIKNAVAAIANIAAGNNEQIQKLE---------------EAGAEPALEKLQSSPNEEVQKNAQ 235
8 -38.7004hxt_A mol:protein length:252 De Novo Protein OR329  ali model follow..  18  2...........NDVEKLVKLL-TSTDSETQKEAARDLAEIASPASAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAAGGVEVLVKLLTSTDSEVQKEAARALANIASPDEAIKAIVDAGGVEVLVKLLTST-DSEVQKEAARALANIASG-PTSAIKAIVDAGGVEVLQKLLTSTDSEVQKLENIKSGGWLE...... 246
9 -38.7004v3q_A mol:protein length:247 YIII_M4_AII  ali model follow..  17  2...........SELPQMVQQL-NSPDQQELQSALRKLSQIASGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAAGALPALVQLLSSPNEQILQEALWTLGNIASGDEQIQAVIDAGALPALVQLLSSPNEQ-ILQEALWTLGNIASGGNEQKQAVK---------------EAGALEKLEQLQSHENEKIQKEAQ 233
10 -38.5004d49_A mol:protein length:243 ARMADILLO REPEAT PROTEIN ARM00027  ali model follow..  17  2.........PGSELPQMVQQL-NSPDQQELQSALRKLSQIASGGNEQQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNNEQIQKAGALSPLVKLLDDASEEVIKEAVWAIANIASNNEQIQKLIEAGALSPLVKLLDDASEE-VIKEAVWAIANIASGNNEMKQKLE---------------EAGALPALEKLQSHANEEVQKNAQ 235
11 -38.1004db9_A mol:protein length:210 Armadillo repeat protein, YIIIM3AIII  ali model follow..  19  2.......RGSGSELPQMVQQL-NSPDQQELQSALRKLSQIASGGNEQQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAAGALPALVQLLSSPNEQILQEALWALSNIASGNEQKQAVKEAGAEPALEQLQSSP-NEKIQKEAQEALEKIQSH................................................ 204
12 -37.8004dba_A mol:protein length:210 Designed Armadillo repeat protein, YIIM3AII  ali model follow..  17  2.......RGSGSELPQMTQQL-NSDDMQEQLSATRKFSQILSGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAAGALPALVQLLSSPNEQILQEALWALSNIASGNEQKQAVKEAGALEKLEQLQSHE-NEKIQKEAQEALEKLQSH................................................ 204
13 -37.7005t94_B mol:protein length:542 Importin subunit alpha  ali model follow..  14  119HRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSQALPTLAKLIYSMDTETLVDACWAISYLSDPQEAIQAVIDVRIPKRLVELLSHE-STLVQTPALRAVGNIVTGNDLQTQVVI-NAGVLPALRLLLSSPKENIKKLVKLLEVAEYKTKKEAC 404
14 -37.5004db6_A mol:protein length:210 Armadillo repeat protein  ali model follow..  19  2.......RGSGSELPQMVQQL-NSPDQQELQSALRKLSQIASGGNEQQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAAGALPALVQLLSSPNEQILQEALWALSNIASGNEQKQAVKEAGALEKLEQLQSHE-NEKIQKEAQEALEKLQSH................................................ 204
15 -37.4005mfd_A mol:protein length:328 YIIIM``6AII  ali model follow..  18  35GNEQIQAVIDAGALPALVQLL-SSPNEQILQEALWTLGNIASGGNEQQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAAGALPALVQLLSSPNEQILQEALWTLGNIASGNEQIQAVIDAGALPALVQLLSSP-NEQILQEALWTLGNIASGGNEQIQAVI-DAGALPALVQLLSSPNEQILQLEQLQSHENEKIQKEAQ 319
16 -37.2004plr_A mol:protein length:289 Arm00008  ali model follow..  18  34GNEQIQAVIDAGALPALVQLL-SSPNEQILQEALWTLGNIASGGNEQQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAAGALPALVQLLSSPNEQILQEALWTLGNIASGNEQIQAVIDAGALPALVQLLSSP-NEQILQEALWTLGNIASGGNEQKQAVK---------------EAGAEPALEQLQSSPNEKIQKEAQ 276
17 -37.1003nmz_A mol:protein length:458 APC variant protein  ali model follow..  12  12GSHMRLTSHLGTKVEMVYSLL-SMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHGNDEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLDHYSITLRRYAGMALTNLTFGDVANKATLGCMRALVAQLKSESEDLQQVIASVLRNLSADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQCLQTLLQHLKSHSLTIVSNAC 394
18 -37.0005aei_A mol:protein length:286 DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII  ali model follow..  19  35GNEQIQAVIDAGALPALVQLL-SSPNEQILQEALWALSNIASGGNEQQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAAGALPALVQLLSSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLLSSPNEQ-ILQEALWALSNIASG-GNEQKQAVKEAGALEKLEQLQSHENEKIQKLEKLQSH.......... 286
19 -36.9005mfm_C mol:protein length:350 Importin subunit alpha  ali model follow..  18  35GNEQIQAVIDAGALPALVQLL-SSPNEQILQEALWALSNIASGGNEQQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAAGALPALVQLLSSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLLSSP-NEQILQEALWALSNIASG-GNEQIQAVIDAGALPALVQLLSSPNEALEKLEQLQSHENEKIQKEAQ 319
20 -36.9004v3r_A mol:protein length:286 YIII_M5_AII  ali model follow..  19  35GDEQIQAVIDAGALPALVQLL-SSPNEQILQEALWTLGNIASGGDEQQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAAGALPALVQLLSSPNEQILQEALWTLGNIASGDEQIQAVIDAGALPALVQLLSSP-NEQILQEALWTLGNIASG-GNEQKQAVKEAGALEKLEQLQSHENEKIQKLEKLQSH.......... 286
21 -36.6005mfl_A mol:protein length:350 (KR)5_GS10_YIIIM6AII  ali model follow..  18  57GNEQIQAVIDAGALPALVQLL-SSPNEQILQEALWALSNIASGGEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAAGALPALVQLLSSPNEQILQEALWALSNIASGNEQIQAVIDAGALPALVQLLSSP-NEQILQEALWALSNIASGGNEQIQAVI-DAGALPALVQLLSSPNEQILQLEQLQSHENEKIQKEAQ 341
22 -36.6005ewp_A mol:protein length:252 ARO (armadillo repeats only protein)  ali model follow..  15  15DILRFDKAYDENDVQEFVNLCSSADPKTIGALSATQLAILASEPHYKDAIREANGIAVFINLLKSHELDRVHAAVVALSFLSVNVKNCICMFESGALPYLISGMKSNIDGMKAACAQTCRNIFVLDKKYKKELGGITQLVNLLELPSNYTQLEAIYHLEDFILNPEFLEAVKNSNSIKNLKTLQQCP-EQDLAEASNVLLLRLTD................................................. 252
23 -36.2004tnm_A mol:protein length:531 Importin subunit alpha  ali model follow..  16  192SPKCRDLVLSYGAMTPLLSQFNENTKLSMLRNATWTLSNFCRGKPPPAFEQTQPALPVLERLVQSMDEEVLTDACWALSYLSDNSNDKQAVIEAGVVPRLIQLLGHSSPSVLIPALRTIGNIVTGDDLQTQMQQALPCLLNLLNNYKKSIKKEACWTISNITANADQIQAVIDAGIIQSLVWVLQSAEF-EVKKEAAWGISNATSGGTHDQIKFMVSQGCIKPLCDLLTCPDEGLEKIENLQSHDNNDIYDKA. 489
24 -36.2003au3_A mol:protein length:344 Adenomatous polyposis coli protein  ali model follow..  11  71DEEHRHAMNELGGLQAIAELLQDHYSITLRRYAGMALTNLTFGDNKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSADVNSKKTLREVGSVKALMCALEVKKESTLKSVLSALWNLSAHCTENKADDGALAFLVGTLQTNTLAIIESGGGILRNVSSNEDHRQILRENNCLQTLLQHLKSH-SLTIVSNACGTLWNLSAR-NPKDQEALWDMGAVSMLKNLIHSKHKMIAMLRNLMAN.......... 344
25 -36.1004rv1_A mol:protein length:420 Engineered Protein OR497  ali model follow..  17  33PASAIKAIVDAGGVEVLVKLL-TSTDSEVQKEAARALANIASGPEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAAGGVEVLVKLLTSTDSEVQKEAARALANIASPTSAIKAIVDAGGVEVLVKLLTST-DSEVQKEAARALANIASG-PDEAIKAIVDAGGVEVLVKLLTSTDSEVQKLVKLLTSTDSEVQKEAA 317
26 -36.1004rxh_B mol:protein length:495 Importin subunit alpha  ali model follow..  20  138SPQCRDYVLSCGALRPLLTLLGDSRKLSMLRNATWTLSNFCRGKTPQQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNIVTDDVQTQVIINCGALPCLLSLLSSNKDGIRKEACWTISNITAGNSAQIQSANIIPPLIHLLSHADLKTRKEACWAISNATSKPDQIRYLVAQGCIKPLCDLLACPDNK-IIQVALDGLENILKVGELDKNAAGDGPDSINRYALFIEECG-GMEKIHDCQTNANEEIYMKAY 440
27 -35.8004b8j_A mol:protein length:528 IMPORTIN SUBUNIT ALPHA-1A  ali model follow..  16  191SPKCRDLVLANGALLPLLAQLNEHTKLSMLRNATWTLSNFCRGKPQPSFEQTRPALPALARLIHSNDEEVLTDACWALSYLSDGTNDKQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGDDAQTQCHQALPCLLSLLQNLKKSIKKEACWTISNITANKDQIQAVINAGIIGPLVNLLQTAEFD-IKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDEGLEKIENLQSHDNNEIYEKA. 487
28 -35.5002jdq_A mol:protein length:450 IMPORTIN ALPHA-1 SUBUNIT  ali model follow..  16  138STMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVCSALQSLLHLLSSPKESIKKEACWTISNITANRAQIQTVIDANIFPALISILQ-TAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSGLDKIEFLQSHENQEIYQKAF 435
29 -35.3003sla_A mol:protein length:168 Catenin beta-1  ali model follow..  16  2SNYQDDAELATRAIPELTKLL-NDEDQVVVNKAAVMVHQLSKKEASRAIMRSPQMVSAIVRTMQNNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAAGGLQKMVALLNKTNVKFLAITTDCLQILA............................................................................................ 167
30 -34.9005tbk_A mol:protein length:521 Importin subunit alpha-3  ali model follow..  13  188GPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVCDALSHFPALLTHPKEKINKEAVWFLSNITANQQQVQAVIDANLVPMIIHLLDKGDFG-TQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAGLEKIEQLQNHENEDIYKLAY 478
31 -34.8004uad_A mol:protein length:479 Importin subunit alpha-7  ali model follow..  16  141SSVCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVCSALPCLLHLLSSPKESIRKEACWTISNITANRAQIQAVIDANIFPVLIEILQKA-EFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSGLDKIEFLQSHENQEIYQKAF 438
32 -34.8002yns_A mol:protein length:490 IMPORTIN SUBUNIT ALPHA-1A  ali model follow..  16  153SPKCRDLVLANGALLPLLAQLNEHTKLSMLRNATWTLSNFCRGKPQPSFEQTRPALPALARLIHSNDEEVLTDACWALSYLSDTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGDDAQTQCHQALPCLLSLLTQNKKSIKKEACWTISNITANKDQIQAVINAGIIGPLVNLLQTAEFD-IKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIGLEKIENLQSHDNNEIYEKAV 450
33 -34.4004e4v_A mol:protein length:485 Importin subunit alpha-2  ali model follow..  13  59KQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGGSVFRDLVIKYGAVDPLLALLAVPDMGYLRNLTWTLSNLCRNKNPAPPIEQILPTLVRLLHHDDPEVLADTCWAISYLTDGNERIGMVVKTGVVPQLVKLLGASELP-IVTPALRAIGNIVTGTDEQTQVVI-DAGALAVFPSLLTNPKTNIQKLVSVLSKADFKTQKEAV 349
34 -34.2003tpo_A mol:protein length:529 Importin subunit alpha-2  ali model follow..  14  151TSEQTKAVVDGGAIPAFISLL-ASPHAHISEQAVWALGNIAGGSAFRDLVIKHGAIDPLLALLHHNDPEVLADSCWAISYLTDPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKAGALAVFPSLLTNPKTNIQKEATWTMSNITARQDQIQQVVNHGLVPFLVGVLSKA-DFKTQKAAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTGLDKIEALQRHENESVYKASL 489
35 -34.1003now_A mol:protein length:810 UNC-45 protein, SD10334p  ali model follow..  11  484INKRITVLANEGITTALCALA-KTESHNSQELIARVLNAVCGLKELRGKVVQEGGVKALLRMALEGTEKGKRHATQALARIGITINPEVSFSGQRSLPLLNLLQQDCTALENFESLMALTNLASMNEQRIIKEQGVSKIEYYLMEDHLYLTRAAAQCLCNLVMSEDVIKMFENNDRVKFLALLCE-DEDEETATACAGALAIITSVSVKCCEKILAIASWLDILHTLIANPSPAVQHILNMINAGEE....... 741
36 -34.1005xgc_A mol:protein length:503 Rap1 GTPase-GDP dissociation stimulator 1  ali model follow..  14  198GDESMQKLFEGGKFQRVLSWI-PSNNHQLQLAGALAIANFARNDANCIHMVDNGIVEKLMDLLEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEMPPVQFKLLGTLRMLIDAQAEAAEQVKLVERLVEWCEAKDHAVMGESNRLLSALSKSKDVIKTIVQSGGIKHLVTMATSEH-VIMQNEALVALALIAALELGTAEKDLESAKLVQILHRLLADERSFLDVVSKLRSHENKSVAQQAS 493
37 -34.0003fex_C mol:protein length:467 Importin subunit alpha-2  ali model follow..  13  40KQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGGSVFRDLVIKYGAVDPLLALLAVPDMSYLRNLTWTLSNLCRNKNPAPPIEQILPTLVRLLHHDDPEVLADTCWAISYLTDGNERIGMVVKTGVVPQLVKLLGASELP-IVTPALRAIGNIVTGTDEQTQVVI-DAGALAVFPSLLTNPKTNIQKLVSVLSKADFKTQKEAV 330
38 -34.0005zhx_A mol:protein length:487 Rap1 GTPase-GDP dissociation stimulator 1  ali model follow..  13  182GDESMQKLFEGGKGSVFQRVLSPSNNHQLQLAGALAIANFARNDANCIHMVDNGIVEKLMDLLEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEMPPVQFKLLGTLRMLIDAQAEAAEQVKLVERLVEWCEAKDHAVMGESNRLLSALSKSKDVIKTIVQSGGIKHLVTMATSEH-VIMQNEALVALALIAALELGTAEKDLESAKLVQILHRLLADERSFLDVVSKLRSHENKSVAQQAS 477
39 -33.8003t7u_A mol:protein length:378 Adenomatous polyposis coli protein  ali model follow..  10  56DEEHRHAMNELGGLQAIAELLQDHYSITLRRYAGMALTNLTFGDNKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSADVNSKKTLREVGSVKALMCALEVKKESTLKSVLSALWNLSAHCTENKADDGALAFLVGTLTTNTLAIIESGGGILRNVSSNEDHRQILRENNCLQTLLQHLKSH-SLTIVSNACGTLWNLSAR-NPKDQEALWDMGAVSMLKNLIHSKHKMIAMLRNLMANRPAK...... 333
40 -33.7001jpw_A mol:protein length:540 BETA-CATENIN  ali model follow..  13  10INYQDDAELATRAIPELTKLL-NDEDQVVVNKAAVMVHQLSKKESRHAIMRSPQMVSAIVRTMQNTDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAAGGLQKMVALLNKTNVKFLAITTDCLQILAGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSV--CSSNKPAIVEAGGMQALGLHLTDPSQLLGTLVQLLGSDDINVVTCAA 291
41 -33.6005ctt_A mol:protein length:447 Importin subunit alpha-1  ali model follow..  14  52KQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGGSAFRDLVIKHGAIDPLLALLAVPDLSTLRNLTWTLSNLCRNKNPAPPLEQILPTLVRLLHHNDPEVLADSCWAISYLTDPNERIEMVVKKGVVPQLVKLLGAT-ELPIVTPALRAIGNIVTG-TDEQTQKVIDAGALAVFPSLLTNPKTNIQKLVGVLSKADFKTQKEAA 342
42 -33.4003oqs_A mol:protein length:510 Importin subunit alpha-2  ali model follow..  12  83KQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKAGALAVFPSLLTNPKTNIQKEATWTMSNITARQDQIQQVVNHGLVPFLVGVLS-KADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTGLDKIEALQRHENESVYKASL 464
43 -33.4004u2x_D mol:protein length:175 Importin subunit alpha-6  ali model follow..  17  1....TQVILNCSALPCLLHLL-SSPKESIRKEACWTVSNITAGNRAQQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQILVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQAYGLDKIEFLQSHENQEIYQKAFDLIEHY............................................................................................. 173
44 -33.3003ifq_A mol:protein length:553 plakoglobin  ali model follow..  16  8INYQDDAELATRALPELTKLL-NDEDPVVVTKAAMIVNQLSKEASRRALMGSPQLVAAVVRTMNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAADGLQKMVPLLNKNNPKFLAITTDCLQLLAGNQESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSV--CPSNKPAIVEAGGMQALGKHLTSNSPVLKILVNQLSVDDVNVLTCAT 289
45 -33.0004wv6_A mol:protein length:471 Importin subunit alpha-1  ali model follow..  13  50KQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGGSVFRDLVIKYGAVDPLLALLAVPDMGYLRNLTWTLSNLCRNKNPAPPIEQILPTLVRLLHHDDPEVLADTCWAISYLTDPNERIGMVVKTGVVPQLVKLLGAS-ELPIVTPALRAIGNIVTG-TDEQTQVVIDAGALAVFPSLLTNPKTNIQKLVSVLSKADFKTQKEAV 340
46 -32.8003tt9_A mol:protein length:233 Plakophilin-2  ali model follow..  12  7..........EMTLERAVSMLEADHLPSRISAAATFIQHECFKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVCGALRNLVFDNDNKLEVAELNGVPRLLQVLKQTRDETKKQITGLLWNLSSNDKLKNLMTEALLTLTENIIIPFSDIFYNVTGCLRNMSSADGRKAMRRCDGLIDSLVHYVRGTIADKATENCVCILHNLSYQLEA............................................. 233
47 -32.5004r0z_A mol:protein length:629 Protein humpback-2  ali model follow..  11  18LTYEGSNDMSGLSLPDLVKLM-CDHDESVVARAVHRAYMLSREDPNAPGFDHRSFVEALMAASKSSNVNVRRNAIGALSHMSEQRGGPLLIFRSGGLAEIIRMLYDSLESVVHYAVTTLRNLLMHVSDSRAQLNAVEALTPHLHKTNPKLLAQVADGLYFLLDDAPSKITFLSLLGPQILVSILRESDHRKLIYTVVRCIRSLSV--CPSNKPALISLGCLPALYVELCTAKDLIIKLLEIIRVANDGMTACAC 302
48 -32.3002z6h_A mol:protein length:644 Catenin beta-1  ali model follow..  13  3INYQDDAELATRAIPELTKLL-NDEDQVVVNKAAVMVHQLSKKESRHAIMRSPQMVSAIVRTMQNTDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAAGGLQKMVALLNKTNVKFLAITTDCLQILAGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKP--AIVEAGGMQALGLHLTDPSQRLVQLVQLLGSDDINVVTCAA 284
49 -32.2001xm9_A mol:protein length:457 plakophilin 1  ali model follow..  11  1..........GLTIPKAVQYL-SSQDEKYQAIGAYYIQHTCFDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFSTTNKLETRRQNGIREAVSLLRRTGPEVFFNATGCLRNLSSADAGRQTMSGLIDSLMAYVQNCDDKSVENCMCVLHNLSTNPKGSGWLYHSDAIRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSQLIGLKEKGLPQIARLLQSGNSDVVRLSNMSRHPLLH...... 365
50 -31.3003gq2_A mol:protein length:651 General vesicular transport factor p115  ali model follow..  15  10GQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLS---KKYRLEVGIQAMEHLIHVLQRSDSEIIGYALDTLYNIISNDEEEEVIKQQENVTLLLSLLEEFDFHVRWPGVKLLTSLLKQLGPQVQ-PMGVSRLMDLLADSREVIRNDGVLLLQALTRNGAIQKIVAFENAFERLLDIITEEDGGIVVEDCLILLQNLLKN-NNSNQNFFKEGSYIQRMKPWFEVGDE..................... 268
51 -31.1003l6x_A mol:protein length:584 Catenin delta-1  ali model follow..  11  37KGGPPPPNWRQPELPEVIAML-GFRLDAVKSNAAAYLQHLCYRNDVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFDQDNKIAIKNCDGVPALVLLRKARDMDLTEVITGTLWNLSSHDSIKMEIDHALHALTDEVIIPHESVLTNTAGCLRNVSSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRGRYIRSALRQEKALSAIADLLTNEHERVVKLRNLAVDARNK...... 389
52 -29.8002z6g_A mol:protein length:780 B-catenin  ali model follow..  14  139INYQDDAELATRAIPELTKLL-NDEDQVVVNKAAVMVHQLSKEASRHAIMRSPQMVSAIVRTMNTNDVETARCTSGTLHNLSHHREGLLAIFKSGGIPALVNMLGSPVDSVLFHAITTLHNLLLHQEGAKMAAGGLQKMVALLNKTNVKFLAITTDCLQILAGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKP--AIVEAGGMQALGLHLTDPSQRLVQLVQLLGSDDINVVTCAA 420
53 -29.5001xqr_A mol:protein length:296 HspBP1 protein  ali model follow..  14  25..KSCLRVLSQPMPPTAGEAE-QAADQQEREGALELLADLCENMDNAADFCQLSGMLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLGHPEHKGTLCSMGMVQQLVALVRTEHS-PFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEELQTCFSSPADDSMDR.. 290
54 -28.0003opb_A mol:protein length:778 SWI5-dependent HO expression protein 4  ali model follow..  11  447.LFNEKYILRTELISFLKREM-HNLSPNCKQQVVRIIYNITRSKNFIPQLAQQGAVKIILEYLQDIGEPIRILGCRALTRMLIFTNPGLIFKKYSALNAIPFLFEQIKLTDNYEALLALTNLASSETSDVSTKVYWSTIENLMLDENVPLQRSTLELISNMMSHPLTIAAKFSLRNFNILVKLLQL-SDVESQRAVAAIFANIATTIPLIAKELLTKKELIENAIQVFADQI------------DDIELRQRLL 720
55 -25.9004gmo_A mol:protein length:684 Putative uncharacterized protein  ali model follow..  13  23PTDPELAKLREDKILPVLKDL-KSPDAKSRTTAAGAIANIVQDAKCRKLLLREQVVHIVLETLTDNNIDSRAAGWEILKVLAQEADFCVHLYRLDVLTAIEHAAKAVLEDITGSLLVLIGLLALARDEAVATKQTILRLLFRLISADIDIYEEAISCLTTLSENLKVGQAITDDQETHVYDVLLKLATGTDRAVMACGVLHNVFTSLQWMDHSPGKDGACDAILIPTLTR........................ 283
56 -24.1004cb9_A mol:protein length:571 BETA-CATENIN-LIKE PROTEIN 1  ali model follow..  12  132MPDLYHLLVELNAVQSLLGLL-GHDNTDVSIAVVDLLQELTDIDTLHDALVDGQVVALLVQNLVKEEADGVHNTLAIVENMAEFRPEMCTEQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLDGIDVLLQQLSAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLR--EKKISRSSALKVLDHAMIGPEGDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHV..... 409
57 -23.8005ufl_A mol:protein length:561 Protein CIP2A  ali model follow..  13  57.............LSCLVELLEDPNSASLILSIIGLLSQLAVDIETRDCLQNTYNLNSVLAGVSSHTDSVFLQCIQLLQKLTYNVKIFYSGANIDELIFLIDHIQSSEDELKMPCLGLLANLCRHNLSVQTVKSFYRTLITLLAHSSLTVVVFALSILSSLTLNEEVGEKLFHAQTFQLIFNILINGDGTLTRKYSVDLLMDLLKNPKIADYLTRYEH-CLHQVLGLLNGKDPDSSS................. 298
58 -23.6004l7m_A mol:protein length:269 Putative uncharacterized protein  ali model follow..  15  35.........DKRALFLILELA-GEDDETTRLRAFVALGEILKRADSDRMMVLERHLDVFINALSQENEKVTIKALRALGYLVKDVPMGSKTFLKA-AKTLVSLLESPDDMMRIETIDVLSKLQPLEDSK----LVRTYINELVVSPDLYTKVAGFCLFLNMLNSSADSGHL--TLILDEIPSLLQ-NDNEFIVELALDVLEKALSFPLLE---------------NVKIELLKISRIVDGLVREGAPIIRLKAK 257
59 -22.1003c2g_A mol:protein length:619 Sys-1 protein  ali model follow..  10  222...TGLIIKLNAVMIGSYRLIAGQNPETLPQNTFDLLGLLLHDSDAIDGFVRSDGVGAITTVVQYPNNDLIRAGCKLLLQVSDAKALAKTPLENILPFLLRLIEIHPDDEVIYSGTGFLSNVVAHKQHVKDISNAIFLLHTIISKYPCEIICNCLRTLNNFLMMWIPTPNGETKTAGPNEKQQVCKFIEIDILKKLMSCLSCEG.................................................. 451
60 -22.0005n3u_B mol:protein length:208 Phycocyanobilin lyase subunit beta  ali model follow..  13  2.............TNELINGVALADTPEKLVKAVQELAL----------AKDVAAIPTLIAVFGYNNPTAAAIASTALVQLGEV-----------AVPQLLTQIDDYNYGARAYSIRTLAAIADPR--------ALDVLIDAATDFAPSVRRAAAKGLGNLHWHKFPDNQTAPKKALETLLFISQ-DAEWSIRYAAIVGLQGLVNIPD-----------LQQPIHTRLKE---------MLASDAEKAVRARIL 195
61 -21.2005n3u_A mol:protein length:276 Phycocyanobilin lyase subunit alpha  ali model follow..  13  48.........ESAAVDALIAALEDEAGYPLRRNAARALGK----------LGNRKAVPGLINCLECPDFYVREAAAQSLEMLKDKTAAPALIKDGGVAQAVQVTGRPHLVQPYEAVLEALGAIGATD--------AIPLIQPFLEHPVSRVQCAAARAMYQLTQEPVYGELLVK----------VLAGNDLNLRRVALGDLGAIG------------YLAAAEAIANAKAENSFKLIALKGLLSISDQAIRVMNL 271
62 -21.0004i2w_A mol:protein length:961 Protein UNC-45  ali model follow..  11  560DADVKEWIVDDSLLLKALVLLAKKAGALCVYTLATIYANLSNAFEKPKALVEEGAVPACVAVSKTESKNALELIARSLLAFAEYEDLRGRIIAEGGTVLCLRLTKEASGEGKIKAGHAIAKLGAKADPMISFPGVVKPLCDLLHPDVEGKANDSLLTLTNLASSDSIRGRILKEKAIPKIEEFWFMTDHEHLRAAAAELLLNLLFFEKEEERLSRASAAGFAILTEIMDEIKSWPEVFKDIAMHEDAETQRRGL 883
63 -20.9003c5w_A mol:protein length:232 PP2A A subunit  ali model follow..  9.............IAVLIDEL-RNEDVQLRLNSIKKLSTIALALGVERLSQSL--LPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNS--LCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLS--EVCGQDITTKHMLPTVLRMAG-DPVANVRFNVAKSLQKIGPILDNSTLQ------------------SEVKPILEKLTQDQDVDVKYFAQ 223
64 -20.5003ltj_A mol:protein length:201 AlphaRep-4  ali model follow..  12  4.......STDPEKVEMYIKNL-QDDSYYVRRAAAYALGK----------IGDERAVEPLIKALKDEDAWVRRAAADALGQIGDER----------AVEPLIKALKDEDGWVRQSAAVALGQIGDER--------AVEPLIKALKDEDWFVRIAAAFALGEIG----------DERAVEPLIKALK-DEDGWVRQSAADALGEI--------------------------GGERVRAAMEKLAETGTGFARKVAV 184
65 -20.5005dcq_A mol:protein length:170 artificial repeat proteins (alphaREP3)  ali model follow..  13  4.......STDPEKVEMYIKNL-QDDSSVVRVTAATALGK----------IGDERAVEPLIKALKDEDWQVRVSAAWALGKIGDER----------AVEPLIKALKDEDSDVRMAAAKALGKIGDER--------AVEPLIKALKDEDSDVRRTAAYALGEIG----------GERVRAAMEKLAE-TGTGFARKVAVNYLETH................................................... 159
66 -20.4002db0_A mol:protein length:253 253aa long hypothetical protein  ali model follow..  13  68..........EPMLKKLFSLLKKSEAIPLTQEIAKAFGQMAKEKPELV----KSMIPVLFANYRIGDEKTKINVSYALEEIAKANPMLMA-----IVRDFMSMLSSKNREDKLTALNFIEAMG--ENSFKYVNPFLPRIINLLHDGDEIVRASAVEALVHLATLND--------KLRKVVIKRLEEDTSSLVNKTVKEGISRLLL................................................. 246
67 -20.4004xvp_D mol:protein length:170 BGFP-C  ali model follow..  12  4.......STDPEKVEMYIKNL-QDDSMRVRYNAATALGK----------IGDERAVEPLIKALKDEDGYVRLEAAEALGEIGDER----------AVEPLIKALKDEDPDVRSEAALALGKIGDER--------AVEPLIKALKDEDRYVRMAAAWALGKIG----------GERVRAAMEKLAE-TGTGFARKVAVNYLETH................................................... 159
68 -20.2003ltm_A mol:protein length:211 Alpha-Rep4  ali model follow..  12  15.......RADPEKVEMYIKNL-QDDSYYVRRAAAYALGK----------IGDERAVEPLIKALKDEDAWVRRAAADALGQIGDER----------AVEPLIKALKDEDGWVRQSAAVALGQIGDER--------AVEPLIKALKDEDWFVRIAAAFALGEIG----------DERAVEPLIKALK-DEDGWVRQSAADALGEI--------------------------GGERVRAAMEKLAETGTGFARKVAV 195
69 -20.0001oyz_A mol:protein length:280 Hypothetical protein yibA  ali model follow..  21.........KKLNDDELFRLL-DDHNSLKRISSARVLQLRG----------GQDAVRLAIEFCSDKNYIRRDIGAFILGQIKICKKCEDNVF----NILNNMALNDKSACVRATAIESTAQRCKKNPIYSP--KIVEQSQITAFDKSTNVRRATAFAISVIN----------DKATIPLLINLLK-DPNGDVRNWAAFAININKYDNSDIRDCFVEDKRVLSVLCDELKKNTVYDDIIEALYKFDDNEIITSAI 274
70 -19.9004lac_A mol:protein length:258 PP2A Scaffold Subunit A, Truncated, an internal deletion of PP2A A  ali model follow..  4....................IASDSSSDSSSSSSSSSSDSDSECESMSLYP----IAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLP--FIVELAEDAKWRVRLAIIEYMPLLAGQLGVEYFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEK-GDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAK--SLQKIGPILDNSSEVKPILEKLTQDQDVDVKYFAQ 249
71 -19.4004xl5_C mol:protein length:263 bGFP-A  ali model follow..  14  4.......STDPEKVEMYIKNL-QDDSPPVRVYAAFALGK----------IGDERAVEPLIKALKDEDASVRYAAATALGQIGDER----------AVEPLIKALKDEDGYVRTAAAEALGQIGDER--------AVEPLIKALKDEDPWVRLTAARALGEIG----------DERAVEPLIKALK-DEDPWVRLTAARALGQIG------------DERAVEPLIKALKDEDASVRKLIKALKDEDEYVRQRAA 215
72 -19.1004jw3_C mol:protein length:139 Alpha-helical artificial proteins  ali model follow..  15  4.......STDPEKVEMYIKNL-QDDSYFVRRAAAAALGK----------IGDERAVEPLIKALKDEDRFVRSSAAYALGEIGDER----------AVEPLIKALKDEDWFVRRAAAVALGEIGGER--------VRAAMEKLAETGTGFARKVAVNYLETHKSLIS........................................................................................ 133
73 -18.6004zv6_A mol:protein length:294 AlphaRep-7  ali model follow..  12  66.......IGDERAVEPLIKAL-KDEDSSVRFSAAYALGK----------IGDERAVEPLIKALKDEDPRVRRIAAGALGEIGDER----------AVEPLIKALKDEDPYVRMAAAYALGKIGDER--------AVEPLIKALKDEDGYVRRAAAYALGKIG----------DERAVEPLIKALK-DEDENVRLAAAQALGKIG------------DERAVEPLIKALKDEDRYVRLMEKLAETGTGFARKVAV 277
74 -18.5004d4z_A mol:protein length:294 DEOXYHYPUSINE HYDROXYLASE  ali model follow..  5......SMVTEQEVDAIGQTLVDPKQPQARFRALFTLRG----------LGGPGAIAWISQAFDDDSALLKHELAYCLGQMQD--------ARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPE--------VLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGPPAEERDVGRLREALLDESRPFERYRAMFALRNAGGEEAALALAELQHEAAVPQLAAALARCTECLAALQAHADDPERVVRESCE 279
75 -18.4004cb8_A mol:protein length:496 BETA-CATENIN-LIKE PROTEIN 1  ali model follow..  11  57MPDLYHLLVELNAVQSLLGLL-GHDNTDVSIAVVDLLQELTDIDTLHDALVDGQVVALLVQNLEKEEADGVHNTLAIVENMAEFRPEMCT-QGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLDGIDVLLQQLTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLR--EKKISRSSALKVLDHAMIGPETDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHV..... 334

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.