Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF10752.9; D3FXJ5_BACPE/1-83; Protein of unknown function (DUF2533 topsan), from PfamA32U

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst MSVHLQIAEQVTNHRRAQKEFLALDEKREAAIDRVVEDAKKGLHISLNEVNAITKEMNQIAQDFYFPPRKEVTTDMVREYINKLast
1 -6.4203wut_A mol:protein length:63 Centrosomal protein of 55 kDa  ali model follow..  14  15.....EMEIQLKDALEKNQQWLVYDQQREVYVKGLLA-----------KIFELEKKTETAAHS.................... 61
2 -5.9002m1u_A mol:protein length:93 myosin light chain MlcB  ali model follow..  8  6SGLVPRGSHMSDEKTQLIEAFYNFDGDYDGFVEEFRGIIRDGLPMTEAEITEFFEAADP........................ 66
3 -5.9002oo2_A mol:protein length:86 Hypothetical protein AF_1782  ali model follow..  11  1MSLEEELRRETLKWLERIEERVKEIEGDEGFMRNIEAYISDSRYF...................................... 45
4 -5.7502bw3_B mol:protein length:84 TRANSPOSASE  ali model follow..  4  10......................TVSADCKKEAIEKCAVVRDCRPFSAVSGSGFIDMIKHVNVEELLPSPITLSRKVTSDAKEK 83
5 -5.7003lsj_A mol:protein length:220 DesT  ali model follow..  11  10........................QQTRHALMSAARHLMESGRGFGSLSLREVTRAIVPAGFYRHFSDMDQLGLALVAEVDET 70
6 -5.6001q5v_A mol:protein length:133 Nickel responsive regulator  ali model follow..  12  4............................................VTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQ 42
7 -5.6004za6_A mol:protein length:192 TetR family transcriptional regulator  ali model follow..  13  4........................DLERRRAIDTAASMYLAEEPLDMSLLAERLG-VGRATLYRWVGNRDELLGTVLAEATER 61
8 -5.5403rtr_A mol:protein length:368 Cullin-1  ali model follow..  10  272LRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAVRIMKMRKVLKHQQLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLER 356
9 -5.3902mvo_A mol:protein length:147 Putative lipoprotein  ali model follow..  13  75...............................VDHGTIECLPSDNAVFVAPDGTTYALNDRAEKAGHPPITPIRAK........ 118
10 -5.3906g1k_A mol:protein length:921 Transient receptor potential cation channel subfamily c member 4a  ali model follow..  7  221FQLSWELQELSKVENEFKAEYEELSHQCKHFAKDLLDQTRSSRELEL---DEANNELARLKLAIKYRQKEFVAQPNCQQLLAS 312
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 1 0 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;