current user: public

If you have questions about the server, please let us know.

Query: PF11047.8; SOPD2_SALTY/1-319; Salmonella outer protein D, from PfamA32U

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MPVTLSFGNRHNYEINHSRLARLMSPDKEEALYMGVWDRFKDCFRTHKKQEVLEVLYTLIHGCERENQAELNVDITGMEKIHAFTQLKEYANPSQQDRFVMRFDMNQTQVLFEIDGKVIDKCNLHRLLNVSENCIFKVMEEDEEELFLKICIKYGEKISRYPELLEGFANKLKDAVNEDDDVKDEVYKLMRSGEDRKMECVEWNGTLTEEEKNKLRCLQMGSFNITTQFFKIGYWELEGEVLFDMVHPTLSYLLQAYKPSLSSDLIETNTMLFSDVLNKDYDDYQNNKREIDAILRRIYRSHNNTLFISEKSSCRNMLILast
1 -109.0005cq9_A mol:protein length:319 Secreted effector protein sopD2  ali model follow..  100  1MPVTLSFGNRHNYEINHSRLARLMSPDKEEALYMGVWDRFKDCFRTHKKQEVLEVLYTLIHGCERENQAELNVDITGMEKIHAFTQLKEYANPSQQDRFVMRFDMNQTQVLFEIDGKVIDKCNLHRLLNVSENCIFKVMEEDEEELFLKICIKYGEKISRYPELLEGFANKLKDAVNEDDDVKDEVYKLMRSGEDRKMECVEWNGTLTEEEKNKLRCLQMGSFNITTQFFKIGYWELEGEVLFDMVHPTLSYLLQAYKPSLSSDLIETNTMLFSDVLNKDYDDYQNNKREIDAILRRIYRSHNNTLFISEKSSCRNMLI 319
2 -91.4005cpc_A mol:protein length:317 Secreted effector protein SopD  ali model follow..  42  1MPVTLSFGNHQNYTLNESRLAHLLSADKEKAIHMGGWDKVQDHFRAEKKDHALEVLHSIIHGQGRGEPGEMEVNVEDINKIYAFKRLQHLACPAHQDLFTIKMDASQTQFLLMVGDTVISQSNIKDILNISDDAVIESMSREERQLFLQICEVIGSKMTWHPELLQESISTLRKEVTGNAQIKTAVYEMMRPAEAPDHPLVEWQDSLTADEKSMLACINAGNFEPTTQFCKIGYQEVQGEVAFSMMHPCISYL--LHSYSPFSEFKPTNSGF-LKKLNQDYNDYHAKKMFIDVILEKLYLTHERSLHIGKDGCSRNILL 316
3 -38.7003cxb_A mol:protein length:336 Protein sifA  ali model follow..  24  1MPITIG-NGFLKSEILTNSPR-----NTKEAWWKVLWEKIKDFFFSTGKAKADRCLHEMLFAERAPTRE---------RLTEIFFELKELACASQRDRFQVHNPENDATIILRIMDQ.......................................................................................................................................................................................................... 103
4 -11.1004puf_A mol:protein length:637 E3 ubiquitin-protein ligase SlrP  ali model follow..  12  171...................................................................................................................................................................................................................................EITHLNVQSNSLTALPETLPPGLKTL--EAGENALTSLPASLPPE-LQVLDVSKNQITVLPETLPPTITTLDVSRNALTNLPEN........ 251
5 -10.9005b0n_A mol:protein length:224 E3 ubiquitin-protein ligase ipaH9.8  ali model follow..  12  37...................................................................................................................................................................................................................................NSDELRLDRLNLSSLPDNLPAQITLL--NVSYNQLTNLPELP--VTLKKLYSASNKLSELPPALPDSLLTMNISYNEIVSLPSLPQALKNL. 142
6 -10.8004b8c_D mol:protein length:727 GLUCOSE-REPRESSIBLE ALCOHOL DEHYDROGENASE TRANSCRIPTIONAL EFFECTOR  ali model follow..  2.............NASTAAVNSI--------GMVPTVGTPVNINVNASNPLLHPHL-SLLNNPIWKLQLHLAAVSAQSLGQPNINAMKKYLATAQQAQQQAQQQAQQQVPGPFGPGPQAAPPALQPTDFQQSHIAEASKSLVDCTKQALMEMADTLTDSKTAKKQQPTGDSTPSGTATNSAVSTPLTPKIELFANGKDEANQALLQHKKLSIENRMVMPKDSKYDDQLWHALDLSNLQIFNISANIFKYDFLTRLYLNGNSLTELPAE-NLSNLRVLDLSHNRLTSLPAELGSCLKYFYFFDNMVTTLPWE........ 311
7 -10.6003e6j_A mol:protein length:229 Variable lymphocyte receptor diversity region  ali model follow..  14  40................................................................................................................................................................................................................YLHDNQITKLEPGVFDSLINLKELYLGSNQLGALPVGVFDSLTQLTLDLGTNQLTVLPSAVRLVHLKELFMCCNKLTELPRGIERLLTHLALDQNQLKSIPHGA....... 148
8 -10.6001wwl_A mol:protein length:312 Monocyte differentiation antigen CD14  ali model follow..  155....................................................................................................................................................................................SIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAQLQGLDLSHNSLRDAAGAPSCDQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQV.. 298
9 -10.5005ufd_A mol:protein length:229 RBC36  ali model follow..  14  40................................................................................................................................................................................................................YLHDNQITKLEPGVFDSLINLKELYLGSNQLGALPVGVFDSLTQLTLDLGTNQLTVLPSAVRLVHLKELFMCCNKLTELPRGIERLLTHLALDQNQLKSIPHGA....... 148
10 -10.3004nkg_A mol:protein length:246 E3 ubiquitin-protein ligase sspH1  ali model follow..  10  3.............................................................................................................................................................................................................................................EYDAVWSKWERDAPAGESPGRAAVVQEMRDCLNNG-NPVLNVGASGLTTLPDRLPPHITTLVIPDNNLTSLPELPEGLREL. 82
11 -10.3003cvr_A mol:protein length:571 Invasion plasmid antigen  ali model follow..  17  60...................................................................................................................................................................................................................................QFSELQLNRLNLSSLPDNLPPQITVL--EITQNALISLPELPASASLKHLDVDNNQLTMLPELPAL-LEYINADNNQLTMLPELPTSLEVL. 165
12 -10.3005kzs_A mol:protein length:340 Putative cell surface protein, similar to internalin proteins  ali model follow..  141.............................................................................................................................................................................................................................DFTGMPDLSQLYMADMMITSDVPDFHTIPKLSTLDLSHNQLTNLPDFQNLTNLAELNLSFNNLTNTMTNFTNLLNNLNLDYNHLNELPSN........ 233
13 -10.3004tzh_A mol:protein length:190 LIC12234  ali model follow..  11  13.............................................................................................................................................................................................................................ALKTPNEVQILDLSRNQLTILPKEIEQLVNLESLHLRDNELTTLPEEIILKNLKYLDISRNQISNFPKEIQKLLEVLFLNGNSLSNLPEEIGELEKL. 112
14 -10.1005ufb_A mol:protein length:248 Tn4-22  ali model follow..  18  60................................................................................................................................................................................................................YLSGNQLQALPVGVFDKLSQLTFLSLDENKLTALPNGVFDKLTELTLNLNTNQLTALPEGDRLVHLKELLMCCNKLTELPRGIERLLTHLALDQNQLKSIPHGA....... 168
15 -10.1003twi_D mol:protein length:179 Variable lymphocyte receptor B  ali model follow..  14...................................................................................................................................................................................................................................SGTTVNCQERSLASVPAGIPTTTQVLHLYINQITKLEPGVFDSLTQLTYLNLAVNQLTALPVGV-TKLTHLALHINQLKSIPMGV....... 101
16 -9.9705hl3_A mol:protein length:361 Lmo2470 protein  ali model follow..  152................................................................................................................................................................................................................YMSEMLITSDELPNFNNIPLLITLDLSSNQLTTIPD-FQNIPNLTFLDLNANLLTNTPDFQNLPKLTDLNLRHNNLTGTMVNYTNLLESLNLDYNFLTELPSN........ 255
17 -9.9305uei_A mol:protein length:249 O13  ali model follow..  18  60................................................................................................................................................................................................................WLNNNQLTSLPAGLFDSLTQLTILALDSNQLQALPVGVFGRLVDLQLYLGSNQLSALPSADRLVHLKELLMCCNKLTELPRGIERLLTHLALDQNQLKSIPHGA....... 168
18 -9.8903g3a_A mol:protein length:178 Variable lymphocyte receptor VLRB.2D  ali model follow..  20.....................................................................................................................................................................................................................................TTVDCSGKSLASVPTGIPTTTQVLYLYDNQITKLEPGVFDRLTQLTRLDLDNNQLTVLPAGV-TQLTQLSLNDNQLKSIPRGA....... 105
19 -9.7802o6s_A mol:protein length:208 Variable lymphocyte receptor B  ali model follow..  15  34................................................................................................................................................................................................................DLETNSLKSLPNGVFDELTSLTQLYLGGNKLQSLPNGVFNKLTSLTLNLSTNQLQSLPNGVKLTQLKELALNTNQLQSLPDGV-TQLKDLRLYQNQLKSVPDGV....... 143
20 -9.7504xsq_A mol:protein length:183 variable lymphocyte receptor-like protein Bf66946  ali model follow..  10  9..............................................................................................................................................................................................................................TVSLYGEMVVACGGMGLTEIPEDIPHRAVYLVLKDNNITKITSYSFKGLRNLQGIDLSNNKINHISSAA-GHLDDIDLSRNELTSVSEKL....... 101
21 -9.7404arn_A mol:protein length:279 TOLL RECEPTOR, VARIABLE LYMPHOCYTE RECEPTOR B.61 CHIMERA  ali model follow..  106.................................................................................................................................................................................................................ESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLDLENLESIEFGSNKLRQMPRGI-PKLKQLNLASNQLKSVPDG........ 212
22 -9.7304po4_A mol:protein length:221 Lampetra planeri VLRC  ali model follow..  13  46................................................................................................................................................................................................................QLNYNQLTGIPPTAFQGLTKLTYLNLDSNQLQYLPVGVFDQLKNLNLRLDFNKLKSLPPRVRLTNLTALYLEYNQLQSIPKGV-VNLETLWLRENKLQSVPDGA....... 155
23 -9.6603g3b_A mol:protein length:170 variable lymphocyte receptor VLRB.2D  ali model follow..  10...................................................................................................................................................................................................................................SGTTVDCSGKSLASVPTGIPTTTQVLYLYDNRITKLEPGVFDRLTQLTRLDLDNNQLTVLPAGV-TQLTQLSLNDNQLKSIPRGA....... 97
24 -9.6604rcw_A mol:protein length:240 SLIT and NTRK-like protein 1  ali model follow..  65................................................................................................................................................................................................................DLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSREKFAGLQNLELNVEYNAIQLILPGTAMPKLRILILNNNLLRSLPVDV--SLSKLSLHNNYFMYLPVAGVLDQL.. 178
25 -9.6103wo9_A mol:protein length:248 Variable lymphocyte receptor C  ali model follow..  14  62................................................................................................................................................................................................................QLDFNQLANIPAEAFHGLTRLTYLALDYNQLQSLPVGVFDQLNNLNLRLQDNQLTSLPPGDSLTKLTYLTLSQNQLQSIPAGV-TNLNRLELSTNQLQSVPHGA....... 171
26 -9.6106bxc_D mol:protein length:178 Variable Lymphocyte Receptor 9 (VLR9)  ali model follow..  20...................................................................................................................................................................................................................................SGTTVDCSGKSLASVPGGIPTTTQVLYLYDNQITKLEPGVFDRLVNLQQLWLEINQLTSLPAGV-TQLSILNMHTNQLKSIPRGA....... 107
27 -9.5304rca_B mol:protein length:251 SLIT and NTRK-like protein 1  ali model follow..  11  69................................................................................................................................................................................................................HMENNGLHEIVPGAFLGLQLVKRLHINNNKIKSFRKQTFLGLDDLELQADFNLLRDIDPGADLNKLEVLILNDNLISTLPANV---ITHLDLRGNRLKTLPYEEVLEQI.. 182
28 -9.5102r9u_A mol:protein length:174 Variable lymphocyte receptor  ali model follow..  13...................................................................................................................................................................................................................................DQTLVNCQNIRLASVPAGIPTDKQRLWLNNNQITKLEPGVFDHLVNLQQLYFNSNKLTAIPTGV-TQLTQLDLNDNHLKSIPRGA....... 100
29 -9.5103o53_A mol:protein length:317 Protein LRIM1  ali model follow..  10  126................................................................................................................................................................................................................YLANNKITMLRDLDEGCRSRVQYLDLKLNEIDTVNELAASSDTLEHLNLQYNFIYDVKGQVVFAKLKTLDLSSNKLAFMGPEFQSAVTWISLRNNKLVLIEKALRFSQNL. 239
30 -9.3904k5u_B mol:protein length:220 Variable lymphocyte receptor  ali model follow..  13  36................................................................................................................................................................................................................YLNSNQITKLEPGVFDRLANLRELHLWGNQLVSLPPGVFDNLANLELWLNSNQLTSLPAGLRLVNLEHLGLCCMKLTELPSGA-TRLKQLGLDQNQLKSIPDGA....... 145
31 -9.3703rfs_A mol:protein length:272 Internalin B, repeat modules, Variable lymphocyte receptor B  ali model follow..  17  91................................................................................................................................................................................................................ILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTLNLAHNQLQSLPKGDKLTNLTELDLSYNQLQSLPEGV-TQLKDLRLYQNQLKSVPDGV....... 200
32 -9.3103oja_A mol:protein length:487 Leucine-rich Immune Molecule 1  ali model follow..  4.EIKQNGNRYKIEKVTDSSLKQALASLRQSAWNVKELD-LSGNPLSQISAADLAPFTKL---------ELLNLSSNVLYETLDLESLSTLRTLDLNNNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKN----------------------------------------------------------------------------YLANNKITMLRDLDEGCRSRVQYLDLKLNEIDTVNELAASSDTLEHLNLQYNFIYDVKGQVVFAKLKTLDLSSNKLAFMGPEFQSAVTWISLRNNKLVLIEKALRFSQNL. 239
33 -9.2904j4l_A mol:protein length:267 Internalin B,REPEAT MODULES,Variable lymphocyte receptor B  ali model follow..  18  84................................................................................................................................................................................................................TLEPNQLQSLPNGVFDKLTNLKELQLWANQLQSLPDGVFDKLTNLTLNLAFNQLQSLPKGDKLTNLTELDLSYNQLQSLPKGV-TQLKDLRLYQNQLKSVPDG........ 192
34 -9.2504y61_B mol:protein length:272 SLIT and NTRK-like protein 2  ali model follow..  12  92................................................................................................................................................................................................................HLGNNGLQEIRPGAFSGLKTLKRLHLNNNKLEVLREDTFLGLESLELQADYNYISTIEAGSKLNKLKVLILNDNLLLSLPSNV-VLLTHLDLRGNRLKVMPFAGVLEHI.. 205
35 -9.1003rfj_A mol:protein length:279 Internalin B, repeat modules, Variable lymphocyte receptor  ali model follow..  17  91................................................................................................................................................................................................................ILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTLYLYHNQLQSLPKGDKLTNLTRLDLDNNQLQSLPEGV-TQLKQLSLNDNQLKSVPDG........ 199
36 -9.0603g06_A mol:protein length:622 SspH2 (Leucine-rich repeat protein)  ali model follow..  13............................................................................................................................................................................................................................SAWRRAAPAEESRGRAAVVQKMRACLNNGNAVL--NVGESGLTTLPDCL-PAHITTLVIPDNNLTSLPALPPE-LRTLEVSGNQLTSLPVLPPGLLEL. 106
37 -9.0104xgo_A mol:protein length:356 Anopheles Plasmodium-responsive Leucine-rich repeat protein 1B  ali model follow..  53................................................................................................................................................................................................................YMRFNVIRYLPPHVFQNVPLLTVLMLDRNDLSSLPPGIFHNTPKLTMSMSNNNLERIEDDQATTALQNLQLSSNRLTHVDLALIPSLFHVNVSYNLLSTLAIPIAVEELDA 166

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35