current user: public

If you have questions about the server, please let us know.

Query: PF11944.8; Y2971_PHOPR/1-125; Protein of unknown function (DUF3461 topsan), from PfamA32U

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MYPHLTSIGIEQPEAIERYSLRQEAANDILKVYFAKNKGELFAKSVKFKFPRQRKSVLVNSGSREYKEITEINRTLTHIIDELDIITKRKHTEVDIKKKILGDLRHLERVVSHKISEIEADLEKLLast
1 -7.1701lki_A mol:protein length:180 LEUKEMIA INHIBITORY FACTOR  ali model follow..  14  31...................AQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNK 136
2 -7.0402q7n_B mol:protein length:180 Leukemia inhibitory factor  ali model follow..  13  31...................AQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSK 136
3 -6.9001emr_A mol:protein length:159 LEUKEMIA INHIBITORY FACTOR  ali model follow..  13  10...................AQLNGSANALFILYYTAQGEPFPNNLEKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSK 115
4 -6.8901a7m_A mol:protein length:180 LEUKEMIA INHIBITORY FACTOR  ali model follow..  14  23.........MNQIKNQLAQL--NGSANALFISYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRMVAYLSASLTNITRDQKVLNPSAVSLHSKLNATIDVMRGLLSNVLCRLCNK 136
5 -6.7103l9f_A mol:protein length:204 Putative uncharacterized protein smu.1604c  ali model follow..  18  36.......LGILSKKERSGYEINDILQNQ-LSYFYDGTYGMIYPTLRKLEKDGKITKEVVIQDGRPNKNIYAITE---SGKKELASYLQSDVNDEIFKSDFLMRLDDLEQLIREEIERKEEKIKRL 157
6 -6.5601l4a_D mol:protein length:87 S-SNAP25 fusion protein  ali model follow..  14  35...........................................................................VSSMIGNLRNMAIDMGNEIGSQNRQVDRIQQKAESNESRIDEANKKATKL 84
7 -6.4905cs4_A mol:protein length:474 Acetyl-CoA carboxylase  ali model follow..  15  257IEPALAFQ---ELGRLSNFNIKPIFTDN-IHVYEAVSKTS--LDKRFFTRGIIRTGHIRDDISIQEYLTSEANRLMSDILDNLEVTDTSNSDLNHIFINFIAVFEDVEAAFGGFLERFGKRLLRL 383
8 -6.4905yl9_A mol:protein length:89 Spike glycoprotein  ali model follow..  19  33....................................................................ITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQLRQNFQAISSSIQAIYDRLDTI 89
9 -6.3501sfc_D mol:protein length:87 PROTEIN (SNAP-25B)  ali model follow..  16  34...........................................................................VSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKM 83
10 -6.2502bh1_X mol:protein length:96 GENERAL SECRETION PATHWAY PROTEIN E,  ali model follow..  14  19...............................................FSFANRFKLVLDWNEDFSQASIYYLAPLSMEALVETKRVVKHAQLIELSQAEFESKLTQVYQRDSSEARQLMEDIGA. 96

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.