current user: public

If you have questions about the server, please let us know.

Query: PF13053.6; Q81Q33_BACAN/1-89; Protein of unknown function (DUF3914 topsan), from PfamA32U

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MQIGSNIHTLSQPTKITPSNLEHNTISSTKLESKKVNDPIKFDIRSSEKEMKQPEHKFNELDLWKMLKDKGVPLWIILEMLQKVRKEKELast
1 -6.5701lmi_A mol:protein length:131 Immunogenic protein MPT63/MPB63  ali model follow..  10  48WEATATVNAIRGSVTPAVSQFNARTADGINYRGEQSTGKIYFDVTGPSPTIVAMNNGMEDLLIWE........................ 130
2 -6.0005lzk_A mol:protein length:180 Protein FAM83B  ali model follow..  18  12..........................HPPRAHLLTIKETIRKMIKEARKVIALVMDIFTDVDIFKEISTRGVSVYILLD.......... 67
3 -5.9604urj_A mol:protein length:185 PROTEIN FAM83A  ali model follow..  11  1........SMASAEKPYLKEKSSATVYFQTVKHNNIRDLVRRCITRTSQVLVILMDVFTDVEIFCDINKRGVFVCVLLD.......... 75
4 -5.6602nlk_A mol:protein length:627 Protein tyrosine phosphatase, receptor type, G variant (Fragment)  ali model follow..  17  363.....................ERARVGLAPLPGMKGTDYINASYIMGYYRSNQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDE. 434
5 -5.4003oc5_A mol:protein length:318 Toxin coregulated pilus biosynthesis protein F  ali model follow..  18  35IKIGMSRDYLENCVKVTSQDMFYDAYPSTESDGAKTRTKEDFSARLLAGDYDSLQKLYIDFYLAQTTFDWEIPTRDQIETLVNYANE.. 124
6 -5.3503qcb_A mol:protein length:310 Receptor-type tyrosine-protein phosphatase gamma  ali model follow..  14  60..........NRYINILAYDHSRVKLRPLPGKDSKHSDYINANYKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRK. 142
7 -5.3402h4v_A mol:protein length:320 Receptor-type tyrosine-protein phosphatase gamma  ali model follow..  14  65..........NRYINILAYDHSRVKLRPLPGKDSKHSDYINANYKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRK. 147
8 -5.3201s20_A mol:protein length:340 Hypothetical oxidoreductase yiaK  ali model follow..  18  154..IGTNPLIVAIPSTMSMSMFSYGMLEVNRLAGRQL--PVDGGFDDEGNLTKEPGVIEKNRRILPMGYWKGSGMSIVLDMI........ 236
9 -5.2704ytp_B mol:protein length:280 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial  ali model follow..  13  1MAAVVAVSLKRWFPATTLGGACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQTYEI---LNNCGP---MVLDALIKIKNEID 84
10 -5.2402hy3_A mol:protein length:313 Receptor-type tyrosine-protein phosphatase gamma  ali model follow..  15  61..........NRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRK. 143

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.