|
current user: public |
|
Query: PF14117.6; D0J295_COMT2/9-67; Domain of unknown function (DUF4287 topsan), from PfamA32U |
. 10 . 20 . 30 . 40 . 50 . | |||||||
# | Score | Template | Links and tools | %id | First | GPASYFPSIEKAYGKPVTHWLKILDELRDKKHMEQVAHLKLEHGIGHGHANALVAYHRA | Last |
1 | -6.900 | 2ww9_O mol:protein length:51 60S RIBOSOMAL PROTEIN L39 | ali model follow.. | 11 | 16 | .........AKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI.............. | 51 |
2 | -6.900 | 3jcs_l mol:protein length:51 ribosomal protein L39e | ali model follow.. | 16 | 16 | .........KMNQNKPVPYWIRLRTGNRIKWNEKRRHWRRTKLNY.............. | 51 |
3 | -6.900 | 5xxb_k mol:protein length:51 Ribosomal protein eL39 | ali model follow.. | 8 | 16 | .........KQKQNRPIPPWIRMRTGSKIRYNAKRRHWRRTKLGM.............. | 51 |
4 | -6.880 | 3j79_e mol:protein length:51 60S ribosomal protein eL39 | ali model follow.. | 13 | 16 | .........CRRQNRPVPHWYRLKKDTKIRYNTKRRHWRRTKLGL.............. | 51 |
5 | -6.840 | 5xy3_l mol:protein length:51 60S ribosomal protein L39, putative | ali model follow.. | 8 | 16 | .........AMKVNRPMPQFIRQMTGVRHIRNPLTRHWRRRKMNI.............. | 51 |
6 | -6.800 | 3j7o_l mol:protein length:51 Ribosomal protein eL39 | ali model follow.. | 8 | 16 | .........KQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL.............. | 51 |
7 | -6.770 | 5lzs_l mol:protein length:51 Uncharacterized protein | ali model follow.. | 8 | 16 | .........KQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL.............. | 51 |
8 | -6.750 | 5t5h_q mol:protein length:50 Ribosomal protein L39 | ali model follow.. | 13 | 15 | .........KLKQNRPVPYWIRLRTGNRIKWNEKRRHWRRTKLHY.............. | 50 |
9 | -6.210 | 5zap_f mol:protein length:112 Small capsomere-interacting protein | ali model follow.. | 9 | 56 | GQAAALTDLGVTHANN------TFAPQPMFAGDAAAEWLRPSFGLKRTYSPFVVRDPKT | 108 |
10 | -5.840 | 6cgr_G mol:protein length:112 Small capsomere-interacting protein | ali model follow.. | 14 | 56 | GQAAALTDLGLAHANN------TFTPQPMFAGDAPAAWLRPAFGLRRTYSPFVVR.... | 104 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Igarashi Y, Eroshkin A, Gramatikova S, Gramatikoff K, Zhang Y, Smith JW,Osterman AL, Godzik A. CutDB: a proteolytic event database. Nucleic Acids Res. 2007 Jan;35(Database issue):D546-9. Epub 2006 Nov 16. |