|
|
current user: public |
|
| Query: PF15102.6; TM154_HUMAN/24-165; TMEM154 protein family, from PfamA32U |
| . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 | |||||||
| # | Score | Template | Links and tools | %id | First | YEELENSGDTTVESERPNKVTIPSTFAAVTIKETLNANINSTNFAPDENQLEFILMVLIPLILLVLLLLSVVFLATYYKRKRTKQEPSSQGSQSALQTYELGSENVKVPIFEEDTPSVMEIEMEELDKWMNSMNRNADFECL | Last |
| 1 | -9.240 | 1onv_B mol:protein length:83 serine phosphatase FCP1a | ali model follow.. | 23 | 40 | .............................................................................HKRKLNEEDAASESSRESSNEDEGSSSEA------DEMAKALEAELNDL................ | 82 |
| 2 | -8.580 | 2na8_A mol:protein length:44 Cytokine receptor common subunit beta | ali model follow.. | 30 | 6 | .............................................DTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRK.......................................................... | 44 |
| 3 | -8.540 | 2na9_A mol:protein length:44 Cytokine receptor common subunit beta | ali model follow.. | 30 | 6 | .............................................DTESVLAMWVLALIVIFLTIAVLLALRFCGIYGYRLRRK.......................................................... | 44 |
| 4 | -7.840 | 2knc_B mol:protein length:79 Integrin beta-3 | ali model follow.. | 10 | 10 | ......................................................ILVVLLSVMGAILLIGLAALLIW--KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTN...................... | 73 |
| 5 | -7.250 | 2lkg_A mol:protein length:140 Acetylcholine receptor | ali model follow.. | 25 | 46 | ....................................................FVVNVIEPCKKFSELTGLVFYL------------PTDSGEKMTESKSVLKSLTEKLKKIVELIPSTSS...................... | 101 |
| 6 | -7.210 | 2maw_A mol:protein length:137 Neuronal acetylcholine receptor subunit alpha-7 | ali model follow.. | 32 | 9 | ....................................................YGLNLLIPCVLISALALLVFLL------------PADSGEKISLGITVLLSLTVFMLLVAEIMPSTSD...................... | 64 |
| 7 | -7.180 | 4jkv_A mol:protein length:475 Soluble cytochrome b562, Smoothened homolog | ali model follow.. | 11 | 287 | ...................LPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVFLIRGVMTLFSIKSNHPGLLSEKAASK------INETMLRLGIF---GFVLITFDFFNQAEWERSFRDYVLCQ.. | 411 |
| 8 | -7.170 | 2lly_A mol:protein length:137 Neuronal acetylcholine receptor subunit alpha-4 | ali model follow.. | 28 | 10 | ....................................................YTINLIIPCLLISCLTVLVFYL------------PSECGEKITLCISVLLSLTVFLLLITEIIPSTSS...................... | 65 |
| 9 | -7.140 | 2lm2_A mol:protein length:137 Neuronal acetylcholine receptor subunit beta-2 | ali model follow.. | 23 | 10 | ....................................................YTINLIIPCVLITSLAILVFYL------------PSDCGEKMTLCISVLLALTVFLLLISKIVPPTSS...................... | 65 |
| 10 | -7.070 | 5ok9_A mol:protein length:246 14-3-3 protein sigma,Heat shock protein beta-6 | ali model follow.. | 15 | 170 | ...........................................................PIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSY------KDSTLIMQLLRDNLTLWTGSGSLRRASAPL | 246 |
FFAS is supported by the NIH grant R01-GM087218-01
|
|
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60. |