current user: public

If you have questions about the server, please let us know.

Query: PF00114.19; Q60163_MORBO/35-157; Pilin (bacterial filament), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst SKSQTTRVVGELAAGKTAVDAALFEGKEPVLQANNADTSKEDIGLTDTSNKPRSNLMSNVELGGFSATSSAGTITGTLGTRANKDITGAKIMQNRAADGVWSCTIDGSAATGWKDKFIPTGCTLast
1 -67.200PF00114.19; Q60163_MORBO/35-157; Pilin (bacterial filament)  ali  100  1SKSQTTRVVGELAAGKTAVDAALFEGKEPVLQANNADTSKEDIGLTDTSNKPRSNLMSNVELGGFSATSSAGTITGTLGTRANKDITGAKIMQNRAADGVWSCTIDGSAATGWKDKFIPTGCT 123
2 -10.500PF11307.8; R7HQ70_9BACT/33-213; Protein of unknown function (DUF3109 topsan)  ali follow..  18  87......................................................................................GRNCVFTCYGENGMCLCAIEKAYRAGKIDFYKPISCH 123
3 -9.590PF11530.8; Q5F9E2_NEIG1/36-162; Minor type IV pilin, PilX  ali follow..  4EKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTLKSKLKIFVSGYKMNPKIAKKYSVSVRFVDAEKPRA---RLVGV---PNAGTGYTLSVWMN-SVGDGYKCRDATSAQAYSDTLSADSGCE 120
4 -8.150PF16541.5; L2GD02_COLGN/38-169; Alternaria alternata allergen 1  ali follow..  21  80...............................................................................................ALNQSWTCNDDPKYPARYTAK-ADLSCE 110
5 -7.150PF08334.11; Q0K5X7_CUPNH/46-154; Type II secretion system (T2SS), protein G  ali follow..  7.EARIVAARQDISSVMQALKLYRLDNSRYPTTEQG........................................................................................ 40
6 -7.110PF17118.5; Q65NT4_BACLD/163-354; Domain of unknown function (DUF5105 topsan)  ali follow..  10  153..............................................................................KAEATSSEKTVEVKLEKSKNDKWKIDADNYKTEQYFSSFL..... 192
7 -7.000PF08805.11; Q4K7M0_PSEF5/41-171; PilS N terminal  ali follow..  1.NSDTAIEQSNISTMVANTKKLKGSAGYGASGAN-------------------MVPSLINLEGTGTMGKNGNTLVNQWNGSVTVVSNGMTFTITESNLPKSACIGGSATTGEILGMTASTSCS 120
8 -6.990PF04809.13; D5WZY2_THIK1/167-283; HupH hydrogenase expression protein, C-terminal conserved region  ali follow..  12  1....VQNAPALLVEIAEKMSTWTPGDQAHVINLTLLPLTREDLIHLGSEL-------------------GVGPATILSRGYGNCRIGATRM------PNVWWVKYFNSQDALILNTIVPA... 95
9 -6.950PF02440.15; Q6QPD0_9ADEN/15-113; Adenovirus E3 region protein CR1  ali follow..  15  62......................................................................................NGTDLILTKAYGGSYYCPGQNTEEMIFYK-VDP.... 99
10 -6.860PF14311.6; D4LD06_RUMC1/288-342; Probable Zinc-ribbon domain  ali follow..  19  2........................................................................HLLSEWDYEKNSKWTPSNVSRNSMKVVWWKCGAGHSYRAKITDRTI-KGCP 53

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.