current user: public

If you have questions about the server, please let us know.

Query: PF00257.19; M4EQW9_BRARP/22-179; Dehydrin, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst VQLTDEFGNPMHITGVASSAPQYKESVTGNIQEYRTAATPAGVAVGTGAAATTAAGVATGETTTGEQQHHESLGEHLRRSGSSSSSSSEDDGQGGRRKKGMKDKIKEKLSGGKHKDEQTPSTATTTGPTTTTGAAAADQHHEKKGILEKIKEKLPGHHLast
1 -81.200PF00257.19; M4EQW9_BRARP/22-179; Dehydrin  ali  100  1VQLTDEFGNPMHITGVASSAPQYKESVTGNIQEYRTAATPAGVAVGTGAAATTAAGVATGETTTGEQQHHESLGEHLRRSGSSSSSSSEDDGQGGRRKKGMKDKIKEKLSGGKHKDEQTPSTATTTGPTTTTGAAAADQHHEKKGILEKIKEKLPGHH 158
2 -10.600PF14925.6; D2H5Y1_AILME/274-908; Domain of unknown function  ali follow..  14  535..........................................................EKENQIDRNSMHNSKVIKRGQDISIKLKTRTGCKSSEKSQSPRTSQVSSYLPSNLSELELNVLDSSTPDHLAEDDEFPS--SKQCKDICELVINKLPGY. 634
3 -9.820PF08568.10; Q6CFU3_YARLI/1-673; Uncharacterised protein family, YAP/Alf4/glomulin  ali follow..  10  1MQLTDDHKKDLEKLGE-----------------------------------------ELKGKEEHTVAGEDEEDVNHGADDSEDAEDEDAEDENDYTELDVDIVCQFIKDAAREAEKTGDYISYATVIDIHCSDPSRYKHVDRVKILTSLLEVLRTNP 117
4 -8.650PF07816.11; F6H1D9_VITVI/111-329; Protein of unknown function (DUF1645 topsan)  ali follow..  15  150............................................................................................SASEGRATDRDPFRKYAGLFRKQDIKNDSFRSIDSSGSMSKRRGPVSAHENRAASEDLKKKLP... 219
5 -8.040PF01080.17; W4XU10_STRPU/68-474; Presenilin  ali follow..  198VETAQERDEQIFPALIY--------SSTMVWLVGMADIDSPPPKSKAKQEPPVEEHTAEENATATGTTVSGQEDQTVSSDQEVNGGFDTVFTERRERDLERSANSSVTSEDRRAAVRALRQNNGPSNRQPPVDEEEEEERGVKLGLGDFI-SVLVGK. 347
6 -7.620PF15712.5; M3Y3S4_MUSPF/713-1384; NPAT C terminus  ali follow..  13  589.............................................................................ARTASTTPLKDNTQQFRASSRSTAKKRKMEE-----LDERERTSRASSKSLANSSLPMKKKKIKKKK--VDKFLLSL---H 669
7 -6.950PF03998.13; L0PCX0_PNEJ8/10-258; Utp11 protein  ali follow..  27  6........................................................................................ERAQPVERQKWGLLEKPKD----------------------------RALDYRSKQLRLKRLREK..... 45
8 -6.750PF16479.5; Q5L9L8_BACFN/5-97; Domain of unknown function (DUF5056 topsan)  ali follow..  26  10......................................................................................................................................GEQKQEIEDNGFSRRVMRNLPGR. 32
9 -6.690PF15424.6; G1R7Z0_NOMLE/16-279; Odontogenic ameloblast-associated family  ali follow..  21  227...................................................................................................................PSTSPKPSTTNVFTSAVDRTITPELPEEKAKTDSLRE--P... 264
10 -6.620PF12336.8; B1PXF9_PIG/112-202; SOX transcription factor  ali follow..  16  4..............................................................................................RRKTKTLMKKDKYTLPGG-------APGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSY 62

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.