current user: public

If you have questions about the server, please let us know.

Query: PF00670.21; SAHH_DICDI/191-351; S-adenosyl-L-homocysteine hydrolase, NAD binding domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst NLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQSLSKMGARVLVTEIDPINALQACMDGYQIVTMETAAPLSNIFVTTTGCRDIVRGEHFAVMKEDAIVCNIGHFDCEIDVAWLNANAKKDTVKPQVDRYTLANGVHIILLAEGRLVNLGCGTGLast
1 -71.000PF00670.21; SAHH_DICDI/191-351; S-adenosyl-L-homocysteine hydrolase, NAD binding domain  ali  100  1NLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQSLSKMGARVLVTEIDPINALQACMDGYQIVTMETAAPLSNIFVTTTGCRDIVRGEHFAVMKEDAIVCNIGHFDCEIDVAWLNANAKKDTVKPQVDRYTLANGVHIILLAEGRLVNLGCGTG 161
2 -48.700PF05221.17; D9SB20_FIBSS/15-498; S-adenosyl-L-homocysteine hydrolase  ali follow..  61  234NLYGCRHSLIDGINRATDVMMAGKIAVVCGYGDVGKGCAQSLRGQGARVIITEIDPICALQAAMEGYEVKTLDEVVSYADIFVTTTGNTGIISAAQMEKMKNRAIVGNIGHFDNEIDMAGLKKIPKRNEIKPQYDEWIFADGHSILVLAEGRLLNLGCATG 396
3 -31.000PF02826.19; Q98GE4_RHILO/107-283; D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain  ali follow..  18  32................ANIELAGKTIGIVGLGAVGQAVGHAAHGFDLKVVATTRSM----QPAPEKVGFLSIDALVEQSDIIVLTPETRGLISRERIARMKPNALLINVSRGPVVDDDALIEALREGRIGGAALDVFSTQPSYNHPYFGFDNVI....... 171
4 -30.500PF00389.30; Q9KCG9_BACHD/20-325; D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain  ali follow..  13  91NTISTAEHTFAMICAFQGTELRGKTLGIIGFGRIGSQIAKRAKAFEMTPYVFDP--LTKARAEKLGVTVASLDDVLQVADIITVTKETKGLLGMKNIGKTKKGVFLINCARGGIIDEEALKHYLREGHIAGAALDVFEEEPVADEELLAFDNVIHIAAST. 277
5 -21.000PF07991.12; ILVC_METAC/15-178; Acetohydroxy acid isomeroreductase, NADPH-binding domain  ali follow..  18  1....................LKDKTIAIMGYGSQGHAHARNLHESGLNVVVGLRKGSSSWAAESDGLKVMTVEEAAKAADVIMILLPDESVYYSQIEPSLEAGNALVFAHG.................................................. 95
6 -17.300PF01262.21; Q9S227_STRCO/141-353; Alanine dehydrogenase/PNT, C-terminal domain  ali follow..  21  26....................VLAGRAVVIGGGVSGWNAAQIAIGLGFHVTLLDKDITKLREADKIFGTKIQLEKACLEADLVIGAVKAPKLVTNELVSRMKPGSVLVDIA................................................... 128
7 -15.300PF00208.21; DHE3_ORYSJ/176-408; Glutamate/Leucine/Phenylalanine/Valine dehydrogenase  ali follow..  11  9...ATGRGVTEALLTEYSESISGSTFVIQGLGNVGSWAAKLIHQKGGKIVLLKHRSEGGSLEDFYGAEVMDAAELLVHECDVLVPCALGGVLNRENAAEVKAR-FIIEGANHPTDTEADEI........................................ 147
8 -14.700PF02882.19; FOLD1_ARATH/184-349; Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain  ali follow..  27  21....TPKGCVE-LLIRTGVEIAGKNAVVIGRSNVGLPMSLLLQRHDATVSTVHA-------------FTKDPEHITRKADIVIAAAGIPNLVRGS---WLKPGAVVIDVG................................................... 110
9 -13.800PF03446.15; Q8FTI1_COREF/15-184; NAD binding domain of 6-phosphogluconate dehydrogenase  ali follow..  14  1........................QIGVVGLAVMGSNLARNFARNGHTVAVYNRSTDKTDKLISDYATDGNFIPTKTVEDFVAALEKPRRAI-NQLADAMEEGDIIIDGGNALYTDTVCREKEMAAR.................................. 115
10 -13.800PF02254.18; Q92CZ9_LISMO/5-120; TrkA-N domain  ali follow..  15  1.........................FAVIGLGRFGGSICRSLVEQGMEVLAIDSDEERVNEYMSIATHAVIANSTIRNFEHVIVAIGEDIQSSILTTLILKEMGVKYVTAKATNDKHAKLLDKIGADRVVHP............................. 116
11 -13.500PF10727.9; Q743Y6_MYCPA/8-128; Rossmann-like domain  ali follow..  11  6........................KVGIISAGRVGTALGVALERADHVVVACSHASRQRAQRRLPDTPVATPPEVAAGAELLLLAVPDSEL-GLAATEAVRAGTIVAHTSGA................................................. 100
12 -13.000PF13241.6; Q2FTK6_METHJ/4-113; Putative NAD(P)-binding  ali follow..  15  3..................IDFTGKKVIIFGGGVIGARKARYFAY-EADVLVYSRSFHPEFQEIPVRTEVCEILRNMIHDASLVIAATSDPELNELIESACAREHIWCNVAAGK................................................ 102
13 -13.000PF02558.16; Q9K9R6_BACHD/6-154; Ketopantoate reductase PanE/ApbA  ali follow..  12  1.........................VAVIGSGSIGLLLYAYLKLANWPALLVTNRPEQADHLNKEGLTFVAKSFSAEEAEVGFITVKSFAVKALLPQLQRKKWDGLVFFQNGMTHLEI--LRQIPARAICCGIVEIGAKRESDVRVQHTGDGAIWIGDMVG 149
14 -12.500PF01488.20; HEM1_PSEAE/169-304; Shikimate / quinate 5-dehydrogenase  ali follow..  12  1...........SLAKQIFSDLHRSQALLIGAGETITLVARHLFEQGVKRIVVANRTLERASLLAEQFLLSEIPEELANSDIVISSTASQLILGKGAVERAHKPMFMVDIA................................................... 110
15 -12.400PF06690.11; D7DUD4_METV3/2-259; Protein of unknown function (DUF1188 topsan)  ali follow..  12  42.......................EQAIIFGAYLSGNYIANTLKADCGEVILIDSQPIKFMDLNTFMLKLRNNKDKEINPDLIIDVTGLGG-VDPNMLKDFDPKVLIIEDPKS................................................. 139
16 -11.500PF16912.5; I7BJ28_NATSJ/144-370; Glucose dehydrogenase C-terminus  ali follow..  14  31......................PASALVLGTGSLGLLTAAMLTETLEYDRVYDRPHPTIDIVDRLGATYIDSRETPVSEDLVYEATGYAKHA-FEAIEALAPNGVAALLG................................................... 130
17 -11.400PF00056.23; MDH_CHLAA/3-142; lactate/malate dehydrogenase, NAD binding domain  ali follow..  1.......................KKISIIGAGFVGSTTAHWLAAKELGDIVLLDFVEGVPQG-----------KALDLYEASPIEGFDVRVTGTNNYADTANSDVIVVTSGAPRKPGMSREDLIKVNADITRACISQAAPLSPNAVIIMVNNPLDAMT... 124
18 -11.100PF13460.6; G2TRC2_BACCO/7-191; NAD(P)H-binding  ali follow..  16  2.............................ANGKIGKILVDLLQKSDRHIRAMVRKEEQAQFFRQKGVDAVELAEAAKGCDIVFTAGSGGHT-AVKTMEAAEKAGIFMIVSALQANHRENWSEAIKPYYVAKHYADRVLQSTKLNYTIIRPGGLLN...... 140
19 -10.900PF01210.23; GPDA_COXBU/7-162; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus  ali follow..  1........................PIAILGAGSWGTALALVLARKGQKVRLWSYESDHVDEMQAEGVNYCDLKASLEGVTDILIVVPSFAFVITRMKPLIDAKTRIAWGTKG-LAKGSRLLHEVVATELGQVPMAVISGPSLATEVAANLPTAVSLASNN. 152
20 -10.900PF02737.18; Q2YR99_BRUA2/5-183; 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain  ali follow..  12  1........................TVGIIGAGQMGSGIAHVCALAGYNVLLHDAAPDRLEKGIATINGNMARQVASGKLQEEQRADAMKLIRPANSMEDLAGVDLAIEAATEDETIKRKIFAQLCP................................... 102
21 -10.400PF03807.17; Q21544_CAEEL/2-98; NADP oxidoreductase coenzyme F420-dependent  ali follow..  11  1........................KIGFIGAGKMAQALARGLINSGRNIIASSPKRDEVFLDQCKALGLHDNAEVVQKSDVVFLAVKPVHVVASEIAPALSKEHLVVSIALG................................................. 97
22 -10.200PF05834.12; LCYB_ARATH/84-479; Lycopene cyclase protein  ali follow..  11  2.........................LAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNVDEFEAMDLLDCLDTTGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQKCITNGVKFHQSKVTNVV---------HEEANSTVVCSDGVKIQVLDATG 137
23 -9.570PF00106.25; YOXD_BACSU/7-201; short chain dehydrogenase  ali follow..  13  1.......................KTALITGGGRIGRATALALAKEGVNIGLIGRTSANVEKVAEE-VKALGVKAAFAAAD--VKDADQVNQAVAQVKEQLGDIDILINNAGISKFGGFLDLSADEWENIIQVNLMGVYHVTRAVLPEMKAGDIINISSTAG 139
24 -9.550PF12076.8; U5FT01_POPTR/449-613; WAX2 C-terminal domain  ali follow..  16  1.........................VLHRGLSKVAYAVALNLCRRGIQVVVPCEDDYQKLKKSFGITSDQNNMILSKSYSIKTWLVGDG--LTEEDQKKAAEGTLFIPFSQFP................................................ 87
25 -9.390PF00899.21; SAE2_HUMAN/11-443; ThiF family  ali follow..  16  4...................AVAGGRVLVVGAGGIGCELLKNLVLTGFHIDLIDLDTIDVSNLN---------RQFLFQKKHV----RSKAQVAKESVLQFYPKANI-VAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAG 133

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.