current user: public

If you have questions about the server, please let us know.

Query: PF00822.20; EMP2_MOUSE/1-165; PMP-22/EMP/MP20/Claudin family, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MLVILAFIIVFHIVSTALLFISTIDNAWWVGDSFSADLWRVCTNSTNCTEINELTGPEAFEGYSVMQAVQATMILSTILSCISFLIFLLQLFRLKQGERFVLTSIIQLMSCLCVMIGASIYTDRRQDLHQQNRKLYYLLQEGSYGYSFILAWVAFAFTFISGLMYLast
1 -90.000PF00822.20; EMP2_MOUSE/1-165; PMP-22/EMP/MP20/Claudin family  ali  100  1MLVILAFIIVFHIVSTALLFISTIDNAWWVGDSFSADLWRVCTNSTNCTEINELTGPEAFEGYSVMQAVQATMILSTILSCISFLIFLLQLFRLKQGERFVLTSIIQLMSCLCVMIGASIYTDRRQDLHQQNRKLYYLLQEGSYGYSFILAWVAFAFTFISGLMY 165
2 -26.100PF07062.12; O45670_CAEEL/8-219; Clc-like  ali follow..  17  2..LLLALSIVLILVGICLTSAGCFSPAWQVRAEHQHGLWWDCIRAEKHVPLHCMYKFDNSAELAWHKAILFFIITSEFLAFISICSGVCAP-------TAFAFSISLFIAMLCSLLADGIFFLAANRVDNRFVQGMVGTYEQRIGYAFYLHLMGTLCWIGAFVC. 200
3 -16.500PF13903.6; TM182_MOUSE/15-220; PMP-22/EMP/MP20/Claudin tight junction  ali follow..  12  2.............LGVLLFLVAFGSDYWLLATEHHEGFFWRCWFSGVVEENNSNIWKFWYTNQPPSKNCAVLLLLGVVAALTASFLIICAAPFSSH-FLYKAGGGSYIASGVLFSLVVILYVIWVQAVADMESYRALRMRSILYGWSFFLAPAGVFFSLLAGLLF 204
4 -16.100PF15108.6; G3H5D6_CRIGR/36-218; Voltage-dependent calcium channel gamma-like subunit protein family  ali follow..  13  20...IRTLIIVCTALAVVLSSVSICDGHWLLVEDRLFGLWYFCTISNHSEP-HCMRDLSQAHMPGLMGLARSVAALAVVAAIFGLELLMVSQVCVRSRRKWAIGSYLLLVAFILSSGGLLTFIILLKS----------QITLMGFTLMFWCEFTASFLFFLNAT.. 173
5 -16.000PF10242.9; LHPL5_RAT/25-202; Lipoma HMGIC fusion partner-like protein  ali follow..  17  1...VGVMWGTLTICFSVLVMALFIQPYWIGDSVSTPGLFSYCVGNVLSSELICKGGPLDFSSSRAFKTAMFFVALAMFLIIGSIICFSL-FFVCNTATVYKICAWMQLAAATGLMIGCLVYSSEVRRMCGEQTGKYTLGH--TIRWAFMLAILSIGDALILSFL. 171
6 -14.500PF07344.11; Q4QIA0_LEIMA/15-170; Amastin surface glycoprotein  ali follow..  12  1...LIAFVAVMVGTGVDMFYNKPEHS---SGARVCITLWTDCRKPKITNPSS-VRWALCPIRLNNFRLCQVFAIISILVYGAAFLFGFLLLYCCS-----GFRWLCLALNIVGAATACVVWAVMVVTYRLPEPKCLELSDGYNFGVGFSLFVFAWILDIVDIIFL 156
7 -11.900PF06687.12; A3LZK7_PICST/5-323; SUR7/PalI family  ali follow..  19  219..................................................................VVSFGFLLTACVLSAISVIIQLLAFFFSPNSCLTFLNFLFQVLVLIVVLVASATATGVFFFVRGQINDHTNEGMKSFLSINFYFAWSAAAAALLVVLF. 319
8 -9.310PF07803.11; F7BNL6_XENTR/10-120; GSG1-like protein  ali follow..  18  8CLNLLALALSITALLSSYWCVGTVQYSWETGDDFHTGIWHSCEENILGTDEKCRSFLELTPPAE..................................................................................................... 110
9 -9.070PF15029.6; H0VXD9_CAVPO/9-242; Transmembrane protein 174  ali follow..  13  27..................................................................KAGATLLFSGIFLGLVGITFTVMGWIKYQSVSHFLLGPILLSVGVTFILIAVCKFKMLSCQLCKESEERVPDSEQTSGGQSFVFTGINQPITFHGATV. 128
10 -8.890PF14985.6; G3I0P6_CRIGR/6-185; TM140 protein family  ali follow..  12  7LPLVGIMVLVAVVLSLMSYALLWKAGNLADLPNLRIGFYNFCLWKEDTGSLQCYNFPELEALG--LALARLGVYGALVLTIFAPLPLLLAQCNGDEGEWRLAVGFVLLASGLGLFLSFVWKWVRLTFLGPGF--------------ALGLAQALLIFLLMTTVML 166

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.