current user: public

If you have questions about the server, please let us know.

Query: PF00927.22; EPB42_HUMAN/588-686; Transglutaminase family, C-terminal ig like domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst PHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVALast
1 -61.200PF00927.22; EPB42_HUMAN/588-686; Transglutaminase family, C-terminal ig like domain  ali  100  1PHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVA 99
2 -20.100PF07705.11; Q8TPY5_METAC/349-453; CARDB  ali follow..  17  2ADLGIQGLAKAWNKLNNTVSVTVINNGPENADSFALELYSDGTPVESRQ--VTGLANGATETVDFSWKPEDIKDYTLKAVVVPGS.............. 91
3 -18.400PF10633.9; Q67M97_SYMTH/263-339; NPCBM-associated, NEW3 domain of alpha-galactosidase  ali follow..  1..........AVAGRKNGVTLEVKNTGTTEITGINFASTLPNWTATFSPDSIDALAPGESRQVTVEVTPNSAGDYLVTLRARS................ 77
4 -16.900PF15780.5; G3VKZ4_SARHA/34-131; Abnormal spindle-like microcephaly-assoc`d, ASPM-SPD-2-Hydin  ali follow..  13  17........GDVRVGVSRTLPLVLDNPNEEGVEVSVARLPAADKGFSISPQSC-ALQSKERISLSITWTPAKEGRVREMITFLVND.............. 92
5 -15.700PF12371.8; A9UVP6_MONBE/19-102; Transmembrane protein 131-like  ali follow..  13  1PVLVPPF-PQQELCKVAERVVTVVNGNPRADLHLY-SISSNSNDFHSSWFEHAVVAPGDNTTFTIAFMSETLGPVEANITLLT................ 84
6 -15.700PF05753.14; Q9VUZ0_DROME/9-186; Translocon-associated protein beta (TRAPB)  ali follow..  18ARLLVS-NKYLVEKSDLLVRYTIFNVGSGAATKVRLV-EAFDVVGGQPTAVVDRIAPQTNFTHVLVVRPKAFGYFNFTAAEVSYKAVEESETLQLAVSS 124
7 -15.700PF05326.11; G1QRT8_NOMLE/4-126; Seminal vesicle autoantigen (SVA)  ali follow..  13  35..KDFDIPKSVRPNEEVTATLAVRTELKECMVVKTYLISSVPLEGGFNYKYTACLCNNNPKTFYWDFYTNRTVQIAAVVDVIREL.............. 117
8 -13.200PF08626.11; C0NZX0_AJECG/5-1447; Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit  ali follow..  19  822...........IAEEPATFKVTLQNPFEFDVEIESLRIDGTGIPFEAAATHGLWLAPFTTQEYYISGVAATEGTLEIR..................... 888
9 -12.900PF14874.6; Q4DUQ4_TRYCC/1589-1690; Flagellar-associated PapD-like  ali follow..  14  2PTLSVMPSGRVIRGNRYALPVVFTNTSTVPCR-YRVTLPTECKDILRVHYPRHFLAPGLTVMAQVEISGTQPLSFSLNVTHEGGLI-------PVKVEI 99
10 -12.400PF12735.7; G3YG86_ASPNA/273-572; TRAPP trafficking subunit Trs65  ali follow..  17  154.SVSFSGPPHVEVGKPFAWSIFIVNRSSGSRKFSIVVGQEAELVSLSTDVRAGPLLPGTCFSTELKLLPLAVGALRLLVDVNTNETIDIKDLPDI.... 298
11 -12.200PF07919.12; C4JTF4_UNCRE/662-1266; Gryzun, putative trafficking through Golgi  ali follow..  495PRVLATVTRASALPNFIHLDYTLENPSIHFLTFTITMEASDQFAFSGPKSLAVQLVPLSRHTVRYNLLAAGNQKWIQ-------MVVDSYYNKTLRVLP 589
12 -12.000PF11797.8; K8E1D6_CARML/133-270; Protein of unknown function C-terminal (DUF3324 topsan)  ali follow..  16  27PQLKMNQIKPALLNYRTAVTVNLQNTEATIIKEFDVHAKGNGTVLHEATKTEMSMAPNSNFDFPISWQSLEPGTYTLDMTAKSGE.............. 117
13 -12.000PF03504.13; OMCBD_CHLTR/92-182; Chlamydia cysteine-rich outer membrane protein 6  ali follow..  10RNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIIT-ATTPTADGKLVWKIDRLGQGEKSKITVWVKP.............................. 91
14 -10.400PF00630.19; DYHA_CHLRE/427-531; Filamin/ABP280 repeat  ali follow..  14......LLAETISGVEVPFIIQAKDTLNDKRTSGGDVFKVTVVSADGKNEGVSRVRDLQNGQYEVQYAAPTAGPYLIHVAFNELGTSDIRGS....... 102
15 -10.300PF13584.6; R5YZT9_9BACE/4-502; Oxygen tolerance  ali follow..  13  10.KFLASAPKQVIQGQQFQVVYTLQNAGGDGFRAPDFSLYGPATSQSTSISWVGKTSKISEYTYTYTLRADKEGSYTFAATIMVDGKQLSSNSLRVQVLP 113
16 -9.910PF06159.13; J3KCX7_COCIM/67-339; Protein of unknown function (DUF974 topsan)  ali follow..  14  4PP------GSAYVGETFSCSLSANNEFSRVVTSIRILAEELYPSSDDNDTKSGGIAQVESMQKIVRFDLKEEGNHVLAVGVS................. 96
17 -9.500PF05506.12; D0IUW9_COMT2/559-647; Domain of unknown function (DUF756 topsan)  ali follow..  12  1PALPYELHTSARCQANSQVELVFANTGTQAAV---FHVYDRYKLDRTPRRY--MVEAGKTLSDTWDAVRDNFGKYDLWVLGPNGFHRHFKG........ 88
18 -9.400PF12690.7; C4L5A1_EXISA/43-141; Intracellular proteinase inhibitor  ali follow..  10  6........AYDASAKTLSATISMTNPNEEAVDRFQLVVKKGD-YMFTESVIEEKWEANDKKVFDEVFLTLEPGEYSVEVIGLGQV.............. 98
19 -9.360PF07610.11; F0NZP4_WEEVC/51-148; Protein of unknown function (DUF1573 topsan)  ali follow..  15  11........GDVKMNESKDHYFVITNEGKSPL---VIKDARATCGCTVPEWPKEPIPAGGKDSIKVQFTAGVLGNTQKKVSLTTN---TAQGLEEFTISA 96
20 -9.320PF14646.6; H0WS01_OTOGA/246-665; MYCBP-associated protein family  ali follow..  11  233...AVRLTFETVEGEKTSSDLTVVNNGTVAIWYDWRRRDLPDTFHDLKRNKMGVILPGETKNFTFFFKSLTAGIFRESWEFGTHPILLGGALLQVNLHS 337

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.