current user: public

If you have questions about the server, please let us know.

Query: PF01184.19; A7TND9_VANPO/71-277; GPR1/FUN34/yaaH family, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst FGGTLNPGLAPAPVHRFANPAPLGLSAFALSTFVLSMYNAGAQGIVVPNLIVGLAMFYGGLMQTIAGIWEIALENTFGGTTLCSYGAFWLSFGAIYIPWFGILEAYTAKPSDLNNALGFYLLGWAIFTLGVVICTMKSTVLFFGLFFMLFMTFLLLCIASFSGRHSVQVAGGVFGVITAFIAWYNAYAGLATRQNSYILAHPFPLPSLast
1 -103.000PF01184.19; A7TND9_VANPO/71-277; GPR1/FUN34/yaaH family  ali  100  1FGGTLNPGLAPAPVHRFANPAPLGLSAFALSTFVLSMYNAGAQGIVVPNLIVGLAMFYGGLMQTIAGIWEIALENTFGGTTLCSYGAFWLSFGAIYIPWFGILEAYTAKPSDLNNALGFYLLGWAIFTLGVVICTMKSTVLFFGLFFMLFMTFLLLCIASFSGRHSVQVAGGVFGVITAFIAWYNAYAGLATRQNSYILAHPFPLPS 207
2 -7.570PF13105.6; C2W8L3_BACCE/9-248; Protein of unknown function (DUF3959 topsan)  ali follow..  18  1.................................................MVLSFLFPIAGIMKQIPLELSFYLGGLLFFTSFGSYYA-WLAYTIFITLLLGIWNQYVTASSLLANA---IAACIAVIPLIFRFRTYAITLGLLALWGGLSLAVLGRIMNLLTAERLYLLLLVVGFIFGGLLA--KLFKQKKKRIMPKVKIRIPSLPR 185
3 -7.140PF05505.12; NCAP_EBOZM/19-734; Ebola nucleoprotein  ali follow..  11  9AGLSVQQGVRQRVIPVYQVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAY--GDYKLFLSGAVKYLEGHGFRFEV-ANAGQF-LSFASLFLPKLVVGEEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIHQGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAK 254
4 -7.000PF04103.15; T176B_MOUSE/60-224; CD20-like family  ali follow..  15  3...........................................................GVTQILLGLVSCALGVCLYFGPWTEL--FWSGSVAILAGVGTIVHEKRQGKGQVSCLLLLACIATAAAATVLGVNSL....................................................................... 85
5 -6.790PF05648.14; Q6FW65_CANGA/12-244; Peroxisomal biogenesis factor 11 (PEX11)  ali follow..  8............LDTTAGREKALRLLQYLCRFLAVQQSSALAKGLQVQFTMVRKILRFLKPLNHLQAASKFYDNKLGNVIKNLAYAGYLTFDQINLLRILKLVPVTQFTGKKVPKLANWFWFVGLISGLVMDVRNICKQRYAAIRRLVWDSFDTFIVLNNLGYLSSSEDSIGLAGVVTSLLGLE....................... 230
6 -6.750PF05297.11; LMP1_EBVB9/1-386; Herpesvirus latent membrane protein 1 (LMP1)  ali follow..  16  4...DLERGPPGPRRPPRGPPLSSSL-GLALLLLLLALL-----------LYIVMSDWTGGALLVL----------SFALMLIIIILIIFIFRRDLLCPL------------------ALCILLLMITLLLIALWNLHGQALFLGIVLFIFGCLLVLGIWIYLLEMLWRLGATIWQLLAFFLAFFLDLILLIIALY............ 159
7 -6.510PF01496.19; E2BB77_HARSA/27-848; V-type ATPase 116kDa subunit family  ali follow..  369YGVASYREANPALYTIVTFPFLFGVMGHGLILTIFAAAMILREKKIIAQKSIANIFFGGRYIILLMGLFSIYAGNDIFSKSVNIFGTSWKINYNESTVEDNPLLQLHPGHDYQGYPYAMGV-VWVLAQ-IVFQNSLKMKMSIILGVVHMIFGVCINIVNIVNFKRYHSLFLEFLPQLLFLILLYMTALMFIK............... 574
8 -6.500PF03745.14; A5GLC4_SYNPW/9-67; Domain of unknown function (DUF309 topsan)  ali follow..  26  34........................................................LLQGILQIAVAHVHLERGNTRGATIL............................................................................................................................. 59
9 -6.480PF02293.15; G8MDZ1_9BURK/1-168; AmiS/UreI family transporter  ali follow..  15  4......................LCLLYVGAVLFLNGLWLLGRIGDREIWVI-----VFAGGVTLLASLKLAFGSGADAASIKAAALTLLFTFTYFWVAINRYNGA--------GRGLGWFSLFVAITIIPVGIDSIAHAALCWFGWAFLWFLFFVLL----ALQRPIVKLTGAVTVIAGIVTGWLPGYLLLNGT............. 168
10 -6.470PF12811.7; D2B2I8_STRRD/5-259; Bax inhibitor 1 like  ali follow..  14  79.......................VIAGLVLGLIVS------FKQSTNPVLILGYAVSYGVAIGVISHMYNNLYNGIVFQAVVGTALAFAAMLAVYSLRIIRVTPKFTKFVVAAGLGLMGLMLVNWVATFF--LAYVFSIAAILIGCFFLLLDFDAVEQGVRAGAPAKYSWLMAFGLTVTLVWIYLEILRLLS............... 251

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.