current user: public
If you have questions about the server, please let us know.

Query: PF01402.21; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst LISVHVPKKMLEELDELVRRGIFPNRSEAIRAALRDLLYKLast
1 -25.300PF01402.21; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family  ali  100  1LISVHVPKKMLEELDELVRRGIFPNRSEAIRAALRDLLYK 40
2 -20.500PF17723.1; A9AUR9_HERA2/2-120; Ribbon-Helix-Helix transcriptional regulator family  ali follow..  30  6.VSMNLSVVDLGQIDLLVDQGFYSSRTDFFRAAIRTRLAG 44
3 -17.300PF03693.14; PARD1_MYCTU/1-80; Bacterial antitoxin of ParD toxin-antitoxin type II system and RHH  ali follow..  28  5.TSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDR 43
4 -8.200PF15919.5; E1VAV2_HALED/3-129; HicB_like antitoxin of bacterial toxin-antitoxin system  ali follow..  24  93.INVTLPELLIKRIDTAVAKQGYQSRSGFLSRAA...... 127
5 -6.990PF09274.10; Q9F809_ERWAM/1-76; ParG  ali follow..  7  37.VNVNFNEEKHTRFKAACVKNG-TSITDVINQLVDNWLTE 74
6 -6.130PF07704.11; A7IPR8_XANP2/1-84; Rv0623-like transcription factor  ali follow..  20  1.MSLNIKNPATVALADELARRQGVTKTAAIHQALSERLHR 39
7 -6.020PF09957.9; B1WYD1_CYAA5/1-47; Bacterial antitoxin of type II TA system, VapB  ali follow..  16  3.TNLEIDDQL---IQEALKIGGHSTKREVVEAALKEYVQR 38
8 -5.860PF12441.8; A1BIF8_CHLPD/6-84; CopG antitoxin of type II toxin-antitoxin system  ali follow..  26  45.ISLRLPEQMLNRIKVLANERDVPYQS-LLKMFLKE.... 78
9 -5.640PF12651.7; A5N8S1_CLOK5/8-51; Ribbon-helix-helix domain  ali follow..  18  5.IYNAVDTILYTKLMQLSKEIMIP-ISKLLDKAVELVPRE 42
10 -5.250PF03869.14; RMNT_BPP22/2-51; Arc-like DNA binding domain  ali follow..  16  7.FNFRMPMEVREKLKFRAEANGRSMNSELLQ......... 36
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 9 4 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Igarashi Y, Eroshkin A, Gramatikova S, Gramatikoff K, Zhang Y, Smith JW,Osterman AL, Godzik A. CutDB: a proteolytic event database. Nucleic Acids Res. 2007 Jan;35(Database issue):D546-9. Epub 2006 Nov 16.