current user: public

If you have questions about the server, please let us know.

Query: PF02085.16; Q6XCI5_DESBA/13-115; Class III cytochrome C family, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst PEGMKAKPKGDKPGALQKTVPFPHSKHATVECAQCHHTLEADGGAVKKCTTSGCHDSLEFRDKANAKDIKLVENAYHTQCIDCHKALKKDKKPTGPTACGKCHLast
1 -39.900PF02085.16; Q6XCI5_DESBA/13-115; Class III cytochrome C family  ali  100  1PEGMKAKPKGDKPGALQKTVPFPHSKHATVECAQCHHTLEADGGAVKKCTTSGCHDSLEFRDKANAKDIKLVENAYHTQCIDCHKALKKDKKPTGPTACGKCH 103
2 -19.200PF02335.15; NRFA_BACFN/56-493; Cytochrome c552  ali follow..  18  120........................EIVNPIGCADCHEPTNMKPQEMRSLVCAQCHVEYYFKGDGKEISQMGIHAQRGVSCADCHMPYKSEGGAMIDRTCQVCH 277
3 -17.200PF13447.6; Q60AB1_METCA/169-436; Seven times multi-haem cytochrome CxxCH  ali follow..  22  1...........................KEVGCIDCHGKVGAQSVMPDRTQCGSCHLQEFAEAESEKDQQWPAEREIAQGCDMCHYQQNKAAEARQPEACATCH 121
4 -17.100PF02276.18; B6ITV4_RHOCS/24-337; Photosynthetic reaction centre cytochrome C subunit  ali follow..  19  74.....................ITEWVSPEQGCAYCHNTKWESHVAQTGVTCYTCHRGQPVQTEATYALMFHLSESMGVNCTFCHNSRSFAQWDQSKVNCTTCH 293
5 -15.600PF03264.14; Q87GW4_VIBPA/15-185; NapC/NirT cytochrome c family, N-terminal region  ali follow..  20  28.......................EATNTEEFCSGCHETIHYSNRSGVRAICSDCHKFQARRGHLAEREWARMKKNDSLECRNCHAAQHSTALASGDKTCVDCH 161
6 -15.200PF14522.6; B3EBL5_GEOLS/40-107; Cytochrome c7 and related cytochrome c  ali follow..  25  1...................VIFSHKVHKGLGCDMCHNHLFEQQAK----------------KVQANKDFVMESLYQGKYCGACHNGSLAF---ASNTRCATCH 67
7 -14.800PF14537.6; D4H4F3_DENA2/139-220; Cytochrome c3  ali follow..  24  3.........................AKAEVFCNGCHGIALPEFSEVSNVTCLGCHGELKALQKKTESAEHKDMNPHKSACTVCHHIHTEQ-----TAYCVNCH 81
8 -13.700PF15135.6; F7F5S5_MONDO/19-277; Uncharacterised protein UPF0515 topsan  ali follow..  17  91......................IAKEDCQFACQPCDFMWWRRVPERKKVRCRKCKVKYDPVPKDKMWGIAEFQ------CLQCGHTFKGFAQMGNPSPCYSCG 166
9 -10.900PF01556.18; T0NBZ6_9EURY/129-343; DnaJ C terminal domain  ali follow..  22  21........................KYRRNAECQTCHG---TGSKDGKLVTCKDCNGTGQQRVVQGQGFFRMVTVT---TCKTCGGRGKVPSVV-----CPDCH 88
10 -10.700PF13435.6; C7LUU2_DESBD/35-108; Cytochrome c554 and c-prime  ali follow..  14  1..............................ACKDCHEEQYEN------------TKYAKKSHSDRSVKIMASDLTEAATCYGCHATSYEKTPHLADAGCEVCH 71
11 -10.300PF03892.14; A0KIM4_AERHH/18-146; Nitrate reductase cytochrome c-type subunit (NapB)  ali follow..  12  55....................................HDTRNYEVDNKVNKCLACHSFKNASAMTRDGMTLGEVSPRRYFCLQCHVPQADA............. 119
12 -10.300PF08902.11; W0EUT5_9BACT/23-290; Domain of unknown function (DUF1848 topsan)  ali follow..  10  189........................ELNLGLELATCAEKVDLLQFGIVHNRCIDPNLISRLKPELQPYIQNLKTDKGQRTLCGCITSNDIGTYNSCPHGCVYCY 267
13 -9.750PF18551.1; A0A0W0YXK1_LEGSP/105-294; Thaumarchaeal output domain 1  ali follow..  16  77.............................QTCSAC-----DSGLLNIKNSCPSCHSINIKPQKGKIGPVPEFLRQERLVCSRCNTRLRTLGVDMEDKLCNDC. 155
14 -9.740PF09788.9; T55BB_DANRE/3-255; Transmembrane protein 55A  ali follow..  12  65.............................ISCRVCQSLISEGKIHQHVVKCGVCNEATPIKNAPAGKKPNPQPTGARVSCGHCAKTFLWTEFTDRTLRCPHCR 181
15 -9.710PF05290.11; Q0ILB1_NPVLS/143-285; Baculovirus immediate-early protein (IE-0)  ali follow..  16  76........................LETPLYECGICTEASTEATFLKPNECCG------------------------FKICNVCYANMWKFSKSAVHPVCPVCK 130
16 -9.330PF09814.9; M1WB37_CLAP2/12-387; HECT-like Ubiquitin-conjugating enzyme (E2)-binding  ali follow..  16  98........................EAGSAVTCERCHSTIIPDGKLKVWKDLPSCHKPHDRDQQENKDLADKGYGANNNVISSSEALANASLESYLHVFCSQCK 223
17 -9.290PF17979.1; F6HGI2_VITVI/253-416; Cysteine rich domain with multizinc binding regions  ali follow..  24  1...............................CPQCGAEYAG-----------LCNPNTV-----------------HLQCHACGGMMPSRNDIGVPQHCLGCD 45
18 -9.200PF09098.10; Q5P0U9_AROAE/48-212; Quinohemoprotein amine dehydrogenase A, alpha subunit, haem binding  ali follow..  12  1.....................VAAQQLLEAKCGACHLDNGKLNRISEIRKSPEGWDMTVVRMADRQGLAPSESAPYRPLTERQPNMQDTAPDEELAQMCGRCH 102

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.