current user: public

If you have questions about the server, please let us know.

Query: PF02112.15; Q5AGE4_CANAL/35-421; cAMP phosphodiesterases class-II, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst INDNLPDQVLCIDAGSGMGKLAEIIHQETTTKTSYCNFLQYYPDCETVSYYYHPNVTITTPFSNFQPGRPILHTQNIFNNLQNYLISHSHLDHVCSVVINSAGFNKNMSNKILYGSHYTINAMQQHLFNGKVWPNMPSFKIVNLNYLESNRSERIGIYTVKMFDLSHGEFNKLTEDKEDAQHHSNSNSNSNNIWGKRYDRRRSSITTIPQNTSGLIIKNSEALNHHYLSSAFLITLEVPCTIKEPPSSILVFGDFESDLTSKLSRNLFIWKSIAPLILRNQLKAIVLECSNCKEIAANELYGHLTPKLLIYELKQLAHECKQLDTATTSTEQPLLGLNVIVNHVKEPIADPNQESQLHDPRKRILAELNKLNEIEKLGCNISIALSGLast
1 -115.000PF02112.15; Q5AGE4_CANAL/35-421; cAMP phosphodiesterases class-II  ali  100  1INDNLPDQVLCIDAGSGMGKLAEIIHQETTTKTSYCNFLQYYPDCETVSYYYHPNVTITTPFSNFQPGRPILHTQNIFNNLQNYLISHSHLDHVCSVVINSAGFNKNMSNKILYGSHYTINAMQQHLFNGKVWPNMPSFKIVNLNYLESNRSERIGIYTVKMFDLSHGEFNKLTEDKEDAQHHSNSNSNSNNIWGKRYDRRRSSITTIPQNTSGLIIKNSEALNHHYLSSAFLITLEVPCTIKEPPSSILVFGDFESDLTSKLSRNLFIWKSIAPLILRNQLKAIVLECSNCKEIAANELYGHLTPKLLIYELKQLAHECKQLDTATTSTEQPLLGLNVIVNHVKEPIADPNQESQLHDPRKRILAELNKLNEIEKLGCNISIALSG 387
2 -14.600PF16661.5; G0VCW5_NAUCC/19-212; Metallo-beta-lactamase superfamily domain  ali follow..  1...............................................ILKFDNVTILIDPGWTEVSYVDCVKYWSNLIPEIDVILISQPTIECLGAYTLLYENFLSHLSRIAVYATLPVANLGRVSTIENKMEVEDIEAAFDHIQILKYSQMIDLDGLTFFALNSGVGGSIWCISTYSEKLVYAPRWNHTRD................................................................................................................................................................................................... 168
3 -13.000PF17030.5; I3EIZ1_NEMP3/1-217; Putative beta-lactamase-like family  ali follow..  14..........................................TQDGYLMESHETSLLFDPPSKVLDSDVELEVIKEYPPDITGIFITNSNSLSVFFVE----------SDVTIYLTDYIYLQMKERLKYYVSLGPITRKKH-RVKIIRHNQVINFTYLSITAQAAGLWIMYAVAQDKEKICAYAYGIPGGSSLAHEMKPSKTPVSLIVNQFLDNKPKNIQDLSK................................................................................................................................................................... 217
4 -9.600PF00753.27; PDLA_RHILO/30-244; Metallo-beta-lactamase superfamily  ali follow..  13  14.....AEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPG-----------------------------ALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHA............................................................................................................................................................................................................................................................................................ 82
5 -8.670PF12706.7; I3ZD26_TERRK/61-263; Beta-lactamase superfamily domain  ali follow..  12  25...........................................................................DHLPPVDAVLLTHAHMDHL-NLPSLRKRHATKLTVIVPKGVADLVENLGFRSVTELEW---------------QTTALADEPVSITMTPARHWGARMFKDTHR---------------------------------------------------GGYVI--------AGAGHSVYHSGDTAYFGHEIGQRL--------------QIALLPIGAYFPDSYRAV----HTSPEEALQAFLDLGA..................................................................... 179
6 -7.570PF13483.6; B9JRY8_AGRVS/77-244; Beta-lactamase superfamily domain  ali follow..  33...............................................................................TPDVVTMNKAHSSHYT--------------LSPDPGIAQVLHGW-----------------NDAQPGEPVHHNLVVGDAYIRNVATDI--------------------------------------------------RSWGGDFEPNGNSIFIFEVA--------GLCIGHLGHLHHEL------------TDKQFAAIGRLDVVMVPVDTLGSDSMSRMVKRLRSALIL............................................................................. 165
7 -6.880PF03574.15; K9PVK6_9CYAN/56-204; Peptidase family S48  ali follow..  15  15...............................................................................................................................................................................................................................HHIEPKRVKVIVREIESALRE-GQLLKMLGSQEPSYLIELPYVHYPLKAGKSPMSGNQLSP-YFEQRLPQDLPQAQVISSLQFSDLIEFLHQRSQ-------EKFPSDRRMPLSEALAEHIKRRLLHAETVMRLDNP........................... 149
8 -6.700PF13691.6; Q6FTI8_CANGA/5-68; tRNase Z endonuclease  ali follow..  23....................................................ERYFFGKVS---EGSQRCLTENKIKISKLGNIFLTGMLDWSAIG................................................................................................................................................................................................................................................................................................... 63
9 -6.550PF05551.11; Q8X1S1_BEABA/120-236; Zinc-binding loop region of homing endonuclease  ali follow..  13  19...........................................................................................................................................................................................................................................................................QVSFKGANKIALLHELVLWADGLQCNPIRNGQHISHLTLGHLVVEDAAINQSRKGCGKIKACRHAGCSKWVYFCDHKPRCIRFVEGFASWKE............................ 117
10 -5.940PF15908.5; H3AQS5_LATCH/557-711; Hyaluronan mediated motility receptor C-terminal  ali follow..  15  22..............................................................................................................................................................................................................................................................LRAEAQKWQSLYEELSNKVKPFAFEAEKNCLLNENGAAQEEAYAKLLGHQNQRQKIKHVVKLKEENSQLRQEVTKLRNQLAKEKQVQKKFEDQMK...................................... 127

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24