current user: public

If you have questions about the server, please let us know.

Query: PF02254.18; Q92CZ9_LISMO/5-120; TrkA-N domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst FAVIGLGRFGGSICRSLVEQGMEVLAIDSDEERVNEYMSIATHAVIANSTDENALRQLGIRNFEHVIVAIGEDIQSSILTTLILKEMGVKYVTAKATNDKHAKLLDKIGADRVVHPLast
1 -60.600PF02254.18; Q92CZ9_LISMO/5-120; TrkA-N domain  ali  100  1FAVIGLGRFGGSICRSLVEQGMEVLAIDSDEERVNEYMSIATHAVIANSTDENALRQLGIRNFEHVIVAIGEDIQSSILTTLILKEMGVKYVTAKATNDKHAKLLDKIGADRVVHP 116
2 -17.800PF13460.6; G2TRC2_BACCO/7-191; NAD(P)H-binding  ali follow..  14  2....ANGKIGKILVDLLQKSDRHIRAMVRKEEQAQFFRQKGVDAVLSDLEGTDELAEA-AKGCDIVFTAGSGDKTLAVKTMEAAEKAGISRFMIVSAKHYADRVLQSTKLNTIIRP 135
3 -14.700PF02558.16; Q9K9R6_BACHD/6-154; Ketopantoate reductase PanE/ApbA  ali follow..  14  1VAVIGSGSIGLLLYAYLKLANWPALLVTNRPEQADHLNKEGLTFVAKSGEHQPILSSFSAEEAEVGFITV--KSFAVKALLPQLQRKKWDGLVFFQNGMTHLEILRQIPARAIC.. 118
4 -13.800PF00670.21; SAHH_DICDI/191-351; S-adenosyl-L-homocysteine hydrolase, NAD binding domain  ali follow..  15  26AVVAGYGDVGKGCAQSLSKMGARVLVTEIDPINALQACMDGYQIVTMETA---------APLSNIFVTTTGCRDIVRGEHFAVMKEDAIVCNIGHFDCEIDVAWLNANAKKDTVKP 132
5 -13.200PF07991.12; ILVC_METAC/15-178; Acetohydroxy acid isomeroreductase, NADPH-binding domain  ali follow..  14  6IAIMGYGSQGHAHARNLHESGLNVVVGLRKGSSSWAKAES-------DGLKVMTVEEA-AKAADVIMILLPDEKQASVYYSQIEPSLEAGNALVFAHG.................. 95
6 -12.400PF10727.9; Q743Y6_MYCPA/8-128; Rossmann-like domain  ali follow..  13  7VGIISAGRVGTALGVALERADHVVVACAISHASRQRAQRRLPDTPVATPPE--------AAGAELLLLAVPDSLAGLVSGLAATEAVRAGTIVAHTSGANGVGILAPLGCI-AIHP 121
7 -12.100PF03446.15; Q8FTI1_COREF/15-184; NAD binding domain of 6-phosphogluconate dehydrogenase  ali follow..  18  2IGVVGLAVMGSNLARNFARNGHTVAVYNRSTDKTDKLISDYATDFIPTKTVEDFVAALEKPRRAIVMVQAGAATDAVINQLADAMEEGDIIIALYTDTVCREKEMAARGRHFVGAG 123
8 -11.500PF06690.11; D7DUD4_METV3/2-259; Protein of unknown function (DUF1188 topsan)  ali follow..  18  45.IIFGAYLSGNYIANTLKADCGEVILIDSQPHLEDIVTGNGIKFMDLNTFMLKLRNNKDKENPDLIIDVTGKDFDPKVLIIEDPKSSFDKELMEADNTHKRLCVGHKKGS...... 163
9 -10.800PF01262.21; Q9S227_STRCO/141-353; Alanine dehydrogenase/PNT, C-terminal domain  ali follow..  18  31AVVIGGGVSGWNAAQIAIGLGFHVTLLDKDITKLREADKIFGTKIQTVVSNAFELEKA-CLEADLVIGAVPGAKAPKLVTNELVSRMKPGSVLVDIAIDQGGCF............ 135
10 -10.700PF05221.17; D9SB20_FIBSS/15-498; S-adenosyl-L-homocysteine hydrolase  ali follow..  13  259AVVCGYGDVGKGCAQSLRGQGARVIITEIDPICALQAAMEGYEVKTLDEV---------VSYADIFVTTTGN---TGIISAAQMEKMKNRAIVGNIGHFDNEIDMAGL........ 354
11 -10.500PF01210.23; GPDA_COXBU/7-162; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus  ali follow..  12  2IAILGAGSWGTALALVLARKGQKVRLWSYESDHVDEMQA--------EGVNNRYLPNYPFPETLKAYCDLKASLEGVTDILIVVPSFAFHEVITRMKP.................. 91
12 -10.000PF02737.18; Q2YR99_BRUA2/5-183; 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain  ali follow..  15  2VGIIGAGQMGSGIAHVCALAGYNVLLHDAAPDRLEKGIATINGNMARQVASGKLQEEEDLAGVDLAIEAATEDETIKRKIFAQLCPVLNPEAILATNTSS................ 116
13 -9.600PF01073.19; O22813_ARATH/15-299; 3-beta hydroxysteroid dehydrogenase/isomerase family  ali follow..  14  1VVTGGLGFVGAALCLELVRRGRQVRSFDHSSPWSDDLKNSGVRCIQGDVTKKQDVDNA-LDGADCVLHLAS-NINGTCNVLEAAFKHEITRIVYVSTYN................. 117
14 -9.510PF03435.18; Q94BZ0_ARATH/41-165; Saccharopine dehydrogenase NADP binding domain  ali follow..  21  1VLVLGTGRVGGSTATALSKLELKIVVGGRNREKGEAMVAKLSEFSQVDINDAKMLETS-LRDVDLVVHAAG............................................. 76
15 -9.410PF03721.14; UGDH_CAEEL/10-205; UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain  ali follow..  13  3VVCVGAGYVGGPTCAMIAHKCPHVTVVDMNTAKIAEWNSDKLPIY--EPGLDEIVFAAAIAEADLIFISVNTPTKM........................................ 91
16 -9.270PF05834.12; LCYB_ARATH/84-479; Lycopene cyclase protein  ali follow..  17  2LAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPK----LIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDL-------SRPYGRVNRKQLKSKMLQKCITNGVK..... 101
17 -9.000PF00208.21; DHE3_ORYSJ/176-408; Glutamate/Leucine/Phenylalanine/Valine dehydrogenase  ali follow..  16  34FVIQGLGNVGSWAAKLIHQKGGKIVAVGDVTGAIRNKSGIDIPALLKHRSEGGSLAELLVHECDVLVPCALGGV----LNRENAAEVKARFIIEGANDTEADEILAKKGV--IVLP 157

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.