current user: public

If you have questions about the server, please let us know.

Query: PF02659.15; MNTP_SHIDS/30-182; Putative manganese efflux pump, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst KPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQILLast
1 -73.200PF02659.15; MNTP_SHIDS/30-182; Putative manganese efflux pump  ali  100  1KPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQIL 153
2 -11.600PF03596.13; Q9JXN6_NEIMB/16-206; Cadmium resistance transporter  ali follow..  17  29......................YLGQFLGSVSLILLSLLFAFLLGLIPILLGIKVLLLGDSDGEAIAKEGLRKDNFLVAMITFASCGADNIGVFVPYTLNLANLIVALLTFLVMIYLLVFSAQKLAQVVGETLEKYSRWFVAVVYLGLGIYIL 179
3 -10.200PF01914.17; YCHE_ECOLI/8-210; MarC family integral membrane protein  ali follow..  10  34AARNKTNLTANLSVAIILWISLFLGDTILQLFGISIDSF-RIAGGILVVTIAMSMISGKLGEDKQNKQEKSETAVRESIGVVPLALPLMAGPGAISSTIVLFGFFVAIALFALCCWGLFRMAPWLVRVLRQTGINVITRIMGLLLMALGIEFI 195
4 -9.790PF04474.12; E8N3Z7_ANATU/2-233; Protein of unknown function (DUF554 topsan)  ali follow..  20  109.........................................FLTASLVFVVGPVAILGAIQDGISGDYR-----------LLAVKSVLDGFASLAFSSSLGIGVAFSAFPILVYQGAISLLAAQVQAITTPEMMNEMTATGGILLMGIAVSGL 209
5 -9.540PF03547.18; PIN6_ARATH/9-565; Membrane transport protein  ali follow..  12  414...SRNPNTYSSLLGLWSLISFKWNIPMPNIVDFSIKIISDAGLGMAMFSLGLFMALQPKM--IPCGAKKATMGMLIRFISGPLFMAGASLLVGLRGSRLHAAIVQAALPQGIVPFVFA-----------REYNLHPDLLSTLVIFGMIVSLP 551
6 -8.050PF01810.18; RHTC_ECOLI/13-206; LysE type translocator  ali follow..  10  14......VSQTAVSRSRKEAMMGVLGITCGVMVWAGIALLGMVGGGLYLCWMGYQMLRGALKKEASAPAPQVELAKSGRSFLKGLLTNLANPKAIIYFGSVFSLFVIIVETLAWFTVVASLFALPQMRRGYQRLAKWIDGFAGALFAGFGIHLI 191
7 -7.680PF05297.11; LMP1_EBVB9/1-386; Herpesvirus latent membrane protein 1 (LMP1)  ali follow..  15  14RPPRGPPLSSSLGLALLLLLLALLFWLYIVMSDWTGGALLVLYSFALMLIIIILIIFIFRRDLLCPLGALCILLLMITLLLIALNLHGQALFLGIVLFIFG-----CLLVLGIWIYLLEML-WRLGATIWQLLAFFLAFFLDLILLIIALYL. 160
8 -7.080PF16955.5; Q97V64_SULSO/1-207; Ferrous iron uptake permease, iron-lead transporter  ali follow..  15  38.........IYAVLGVAIVLIPT--FTLGKLIYLVPLNYVLLASAVILFYFGYRLIRSARRSFKGIKKKGGEEKEEGLSVVFTVSA-IEGLEASL-LALIPQSYSSAVMGAILASVLVVILTAILKSQVARIRLPHLKFVLSALLFSLGT... 176
9 -6.930PF17461.2; Y005_CHLTR/16-363; Family of unknown function (DUF5423 topsan)  ali follow..  18  2..............GLLSRFLPKLRYVYDIAL----------IAISILCIVSIILWTQG-----------------SGLALFAIAPALAIGALGVTLLVSDLAESQKSKEIADTVAAVSLPFILTGTAAGLMFS--AIAVGGGAVILLGFALM 128
10 -6.850PF10176.9; M1VXF7_CLAP2/112-320; Protein of unknown function (DUF2370 topsan)  ali follow..  20  68.....................................................................................VYVDGMPVGSVFSFI------------MISTSFQLVGFLLTYLLSTHAAKNGSRAGGITLIQYGFYM. 127

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.