current user: public

If you have questions about the server, please let us know.

Query: PF02691.15; VACA3_HELPX/43-1023; Vacuolating cyotoxin, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980
# Score Template Links and tools%idFirst AFFTTVIIPAIVGGIATGAAVGTVSGLLSWGLKQAEQANKAPDKPDKVWRIQAGRGFDNFPHKQYDLYKSLLSSKIDGGWDWGNAARHYWVKDGQWNKLEVDMQNAVGTYNLSGLINFTGGDLDVNMQKATLRLGQFNGNSFTSFKDGANRTTRVNFDAKNILIDNFVEINNRVGSGAGRKASSTVLTLKSSEKITSRENAEISLYDGATLNLVSSSNQSVDLYGKVWMGRLQYVGAYLAPSYSTIDTSKVQGEMNFRHLAVGDQNAAQAGIIANKKTNIGTLDLWQSAGLSIITPPEGGYESKTKDNPQNNPKNDAQKTEIQPTQVIDGPFAGGKDTVVNIFHLNTKADGTLRAGGFKASLSTNAAHLHIGEGGVNLSNQASGRTLLVENLTGNITVEGTLRVNNQVGGAAIAGSSANFEFKAGEDTNNATATFNNDIHLGKAVNLRVDAHTANFNGNIYLGKSTNLRVNGHTAHFKNIDATKSDNGLNTSTLDFSGVTDKVNINKLTTAATNVNIKNFDIKELVVTTRVQSFGQYTIFGENIGDKSRIGVVSLQTGYSPAYSGGVTFKGGKKLVIDEIYHAPWNYFDARNVTDVEINKRILFGAPGNIAGKTGLMFNNLTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSTTGFYKPLIKINNAQNLTKNKEHVLVKARNIDYNLVGVQGASYDNISASNTNLQEQFKERLALYNNNNRMDTCVVRKDNLNDIKACGMAIGNQSMVNNPENYKYLEGKAWKNTGINKTANNTTIAVNLGNNSTPTNSTTDTTNLPTNTTNNARFASYALIKNAPFAHSATPNLVAINQHDFGTIESVFELANRSSDIDTLYANSGAQGRDLLQTLLIDSHDAGYARTMIDATSANEITQQLNAATTTLNNIASLEHKTSGLQTLSLSNAMILNSRLVNLSRKHTNHIDSFAKRLQALKDQRFALast
1 -272.000PF02691.15; VACA3_HELPX/43-1023; Vacuolating cyotoxin  ali  100  1AFFTTVIIPAIVGGIATGAAVGTVSGLLSWGLKQAEQANKAPDKPDKVWRIQAGRGFDNFPHKQYDLYKSLLSSKIDGGWDWGNAARHYWVKDGQWNKLEVDMQNAVGTYNLSGLINFTGGDLDVNMQKATLRLGQFNGNSFTSFKDGANRTTRVNFDAKNILIDNFVEINNRVGSGAGRKASSTVLTLKSSEKITSRENAEISLYDGATLNLVSSSNQSVDLYGKVWMGRLQYVGAYLAPSYSTIDTSKVQGEMNFRHLAVGDQNAAQAGIIANKKTNIGTLDLWQSAGLSIITPPEGGYESKTKDNPQNNPKNDAQKTEIQPTQVIDGPFAGGKDTVVNIFHLNTKADGTLRAGGFKASLSTNAAHLHIGEGGVNLSNQASGRTLLVENLTGNITVEGTLRVNNQVGGAAIAGSSANFEFKAGEDTNNATATFNNDIHLGKAVNLRVDAHTANFNGNIYLGKSTNLRVNGHTAHFKNIDATKSDNGLNTSTLDFSGVTDKVNINKLTTAATNVNIKNFDIKELVVTTRVQSFGQYTIFGENIGDKSRIGVVSLQTGYSPAYSGGVTFKGGKKLVIDEIYHAPWNYFDARNVTDVEINKRILFGAPGNIAGKTGLMFNNLTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSTTGFYKPLIKINNAQNLTKNKEHVLVKARNIDYNLVGVQGASYDNISASNTNLQEQFKERLALYNNNNRMDTCVVRKDNLNDIKACGMAIGNQSMVNNPENYKYLEGKAWKNTGINKTANNTTIAVNLGNNSTPTNSTTDTTNLPTNTTNNARFASYALIKNAPFAHSATPNLVAINQHDFGTIESVFELANRSSDIDTLYANSGAQGRDLLQTLLIDSHDAGYARTMIDATSANEITQQLNAATTTLNNIASLEHKTSGLQTLSLSNAMILNSRLVNLSRKHTNHIDSFAKRLQALKDQRFA 981
2 -8.460PF05695.12; YCF2_VITVI/1-1488; Plant protein of unknown function (DUF825 topsan)  ali follow..  10  956..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................INGGTISPFLFNKIPKWMIDSFHSRNNRRKSFDNTDSYFSMISHD---DNWLNPVKPFHRSS--------------LISSFYKANRLRFLNNPHRFCFYCNKRFPFYVEKARINNSDFTYGSLCGGKKKHAFLERDTISPIESQVSNNDFPQSGDETYNLYKSFHFPIRSNPFVRRAIYSIADISGTPLTEGQIVNFERTYCQPLSDMNLSDSELNFNSNMGLIHTPCSEKYLPSEKRKKRSLCIKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT-LTSTGYKYL------SDLLPILSSSPKFVSIFHDIMYGSDI--NLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSI-LFLLLVAGYLVRTHLLFVSRASSEL-VKSLMIPSYMIELRKLLDRYPTSEFLVALEQLGDSLEEIRASGGNMLLGGGPAYGVKSIRSKKLIDLISINPINRITFSRNTRCLSH.... 1486
3 -7.700PF15440.6; W5NH69_LEPOC/112-758; THRAP3/BCLAF1 family  ali follow..  423.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KIVPGEASRPEVKVKIASLAYDDPSPGTSLTSDRSLASALVHSTKREQG---------------FRSIFDHIKRPQAYK--------------------NSAESFIQHIV--SLVHHVKEHFKSTGMSLHEFTAYQKAAEGHEVRQKSPEI---HRRIDISRKDRCDAADLRHDIDRRRKER.. 584
4 -7.430PF05786.14; G3J5P2_CORMM/14-857; Condensin complex subunit 2  ali follow..  12  23.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ERGKRINSRKALHDKQINQLKAAASGSRKSSLGIEDIENAAPGSNAGTPRASRGLDLSDDPIMINGVNLTPVKRVPILANFEEWMKMATDNK--SWN-FALIDYFHDMSLDGCVKIYTR--VDSTETGKLLSGLADSNSK-VDEDGNVKKKPKKKSQRSEATLAPSFTSLQLKKFELESVDPLFKKASADFDE... 250
5 -6.970PF09730.9; H3DKP7_TETNG/4-712; Microtubule-associated protein Bicaudal-D  ali follow..  19  544.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DQIKHL------QLAVDRTTELSRQRVASLELGTVADKDKEAC-----MEEILKLKSLLSTKR-----EQIATLRTVLKANKQTAEVAL--ANLKSKYEN-VTETMMKLRNELKGLKEDAATFSSLRAMF-ATRCDEYVMQLEEMQRQL--TAAEDEKKTLNSLLRMAQKLALTQRLEDLE....................... 708
6 -6.760PF15324.6; H9GLI0_ANOCA/127-1404; Hedgehog signalling target  ali follow..  11  6............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................QYDAGQK----------EAVRAVFKQRVQNAPVFKEVKVQLLGNTCSNKK--------DSPKSSHSEMDSAATIAAATAAAIAS--------------------------------------TAPLLKVQS--DFEAKVSSVSKILNKLQETDRERQSSLKAPTRERSPCHQRFGELEKQMHLFMEQRLRNLENFQQQQM. 153
7 -6.590PF04625.13; DEC12_DROME/74-480; DEC-1 protein, N-terminal region  ali follow..  14  269.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EKTLEDLRVEAKLRAFERQVIAELRMLQKIELMAKQMRSSAAAQNGDSPYRISYPLSRTPIHKITRADIEQALR--------------------DYVRRLVNKEAQRRARNSGINTQKANALKRQAKSQDQTLSDIVQI-----MAYAYRMANEQMESEK............................ 406
8 -6.480PF03699.13; G7V5H5_THELD/27-780; Uncharacterised protein family (UPF0182 topsan)  ali follow..  196...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................VASWGAGFWLERFNL--LFSPQGVVFGAGYTDIHARLLGINVMFALSMIVAILLLVNI---MRRTWKLAAVALVLLVASNIVIRGVYPGIVQKYVV--EPNEYQKEAPYIQYNIESTLKA---YGLDSLKTVDFLPANSVTWEQIQKEKETINNIRLWDYRPLLRTYKQLQEIRSYYDFNDIDDRYNLGGSYRQVMLSARELDLQQLQNPTWVNMHLEFTHG-----YGVVMNPVTEIDPEGKPVFFIKDLPPRISVPLEIERPQIYYGEKVQPYVLVKTKIKEFDYPMGGANVRTTYEGTGGVAIGSIWRRLAFAVRFRDSQILFTDAILPE---------SRIMFYRSIGERVRKVAPFLLYLTIMDGKLVWTATNLYPYSEPVSTPAGRINYIRNTVDAYN-GEMNFYIADTEDPLTLFKPMDEAPASFRKIRYPKGLFLIQSEI-FRTYHMKDTNTFYNK.......... 658
9 -6.260PF15351.6; H0V6H9_CAVPO/1-1348; Junctional protein associated with coronary artery disease  ali follow..  575.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MQTKKSSKKKTNETIFCLVSIPVKSESHLPEIDTNNNDLKQSADKKPGIDKSLALQEQSLLSMSSTDLELQALTGSMAGKTEFPKQDQEEPEGDKQTDDFRFI--------HLAKHRALKYS-------------GSWPGNQYRDQQTQTSFPEESKSSQLLPASMLGELSDTAPMPERLEATGSHRHVPFGSSDQKQKA---------------YAPNLKGQTSLN--------SSNSAFSRTSPTTSQAPVLKAG-DVRGQGASPVPKPEVVKGEPTAGPCNSKQLFGQFLLKVSRR-ISQLESFNKELQEGEDSP.. 858
10 -6.250PF05911.11; W1PWE2_AMBTC/32-946; Filament-like plant protein, long coiled-coil  ali follow..  11  6.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KQHSKVAEEAIAGWEKAEAEAASFKQELDG------VRQKVAAEERIVQ-AALKEC------TRQLRHVREEQEERIHDAIDMDKVRIEIEEKLSETSKRLIQ------VTADNNQLHKALQVQEKLEEISERKSQAEADFNALLSAEKDNSALKEIR-SSEASRKQHLESMKKIAKLEME--CQRLRLLVRKRL. 210

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24