current user: public

If you have questions about the server, please let us know.

Query: PF02791.17; K7KRA7_SOYBN/303-360; DDT domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .
# Score Template Links and tools%idFirst SCVGELLMVWDFLSSFGRLLQLSPYSLEDFEIAICHKDSNVALVVESHAALFRLLIKDLast
1 -42.800PF02791.17; K7KRA7_SOYBN/303-360; DDT domain  ali  100  1SCVGELLMVWDFLSSFGRLLQLSPYSLEDFEIAICHKDSNVALVVESHAALFRLLIKD 58
2 -4.640PF07688.12; K9TGJ3_9CYAN/224-345; KaiA C-terminal domain  ali follow..  21  54.........................KIDEMVSTAFLADISVTQIVEIHMDLMDDFSKQ 86
3 -4.630PF07216.12; Q7N0X0_PHOLL/7-92; LcrG protein  ali follow..  30  3.........................VLQAAEAAIKDSDHRLQLLQEMWQSL....... 28
4 -4.600PF02294.18; DN7_METS5/4-61; 7kD DNA-binding domain  ali follow..  16  15..ISKVKKVWKV--------KMVSFTYDD--GAVSEKDAPKELLNMI........... 56
5 -4.440PF18122.1; H3CPS1_TETNG/1628-1784; Anaphase-promoting complex sub unit 1 C-terminal domain  ali follow..  1..........EAITTFTSEPALVSFA-KFFCKTSEDGNYGADSLLLFSSMLYECVTQE 47
6 -4.330PF11565.8; Q8NRS3_CORGL/28-126; Alpha helical Porin B  ali follow..  10  1...........................SDFANLSSTNKELSPQYNWVACGILEGGLK. 30
7 -4.250PF02228.16; GAG_HTL1C/1-92; Major core protein p19  ali follow..  14  19......LAAHHWLNFLQAAYRLEPYDFHQLKKFLKIALETPVWICPINYSLLASLL.. 72
8 -4.220PF16204.5; H0WSN6_OTOGA/416-637; BDHCT-box associated domain on Bloom syndrome protein  ali follow..  10  126...................CEVDNFDIDDFDDDDDWENIMHNLAASKSSTTAHQPIRE 164
9 -3.980PF09262.11; G4TF55_SERID/110-185; Peroxisome biogenesis factor 1, N-terminal  ali follow..  12  1.................KSVSTEPLTPDDWILELHAQYVEDNLLSQVRVA........ 34
10 -3.890PF05886.11; F8_VAR67/1-65; Orthopoxvirus F8 protein  ali follow..  27........SYEEIAKYGHSFNVKRFTNEEMC........................... 49

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.