current user: public

If you have questions about the server, please let us know.

Query: PF03171.20; ACCO1_ARATH/158-259; 2OG-Fe(II) oxygenase superfamily, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst PAFGTKVAKYPECPRPELMRGLREHTDAGGIILLLQDDQVPGLEFFKDGKWVPIPPSKNNTIFVNTGDQLEILSNGRYKSVVHRVMTVKHGSRLSIATFYNPLast
1 -73.900PF03171.20; ACCO1_ARATH/158-259; 2OG-Fe(II) oxygenase superfamily  ali  100  1PAFGTKVAKYPECPRPELMRGLREHTDAGGIILLLQDDQVPGLEFFKDGKWVPIPPSKNNTIFVNTGDQLEILSNGRYKSVVHRVMTVKHGSRLSIATFYNP 102
2 -8.970PF08007.12; Q9CP87_PASMU/26-337; Cupin superfamily protein  ali follow..  10  110...............APAGGSVGRHYDEYDVFL---------VQGYGHRRWQLGKWCLILDEVMAPGDILYV------SRLSHYGVAQDDCLTFSFGL.... 198
3 -8.840PF05118.15; A2SI92_METPP/69-223; Aspartyl/Asparaginyl beta-hydroxylase  ali follow..  11  58............CPQTVALLKSIPSIKAAMFASLPPGATLVDPYAGSLRYHLGLTTPNDPGCFIEVDGQRYHWKDGEVETFIHHAANETQQQRVVLFCVERP 155
4 -7.430PF09859.9; Q98JN4_RHILO/75-246; Oxygenase, catalysing oxidative methylation of damaged DNA  ali follow..  17  77........................HQDLYQVAILLSEDFTGGEFALTEQR-EVVPLRQGDAVAFAVHNRPVQGTKGNYRVLRHGVSRLRSGMRHTVGIIF.. 169
5 -7.270PF17301.2; A0A1A0R1N9_9MYCO/32-144; Putative lipoprotein LpqV  ali follow..  18  37PADSTEDEYYKACTAAREWMAQQGGDPHEQIEPYLGMLQSTD-----GTPWSQLPPPRQAAVIVAV.................................... 104
6 -6.870PF11161.8; A1VIV9_POLNA/1-181; Protein of unknown function (DUF2946 topsan)  ali follow..  15  3DIVKQAIAKWPNVPDCYGWLGLDARGNWYMRDDRAQSAGPFALVGDADRHAAS-SLLKHDKLIDFIQRNYESDASGRW-------FFQNGPQRVYVELEATP 98
7 -6.630PF10596.9; G0W883_NAUDC/1515-1673; U6-snRNA interacting domain of PrP8  ali follow..  17  89PNRRFTLWWSPTINRANVYVGFVVQLDLTGIFL-IPTLKISLVQIFRAHLWQKIHE----SVVFDICQILD............................... 157
8 -6.540PF02043.17; B4S3U2_PROA2/4-82; Bacteriochlorophyll C binding protein  ali follow..  23  16..........................................LEVFIDGHWWVV-----GDALENVGKTTKRLGANAYPHLYGGTSGGMRGSSPEVSGYAKP 70
9 -6.430PF01855.19; KORA_ARCFU/14-229; Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg  ali follow..  14  14.........YPITPSSEIAHGMAELLPKFGGVFIQMEDEIASISAVIGASMAGAV-----AMTATSGPGFSLMQEGMGYAAITES................. 84
10 -6.270PF18259.1; E9SE58_RUMAL/34-170; Carbohydrate binding module 65 domain 1  ali follow..  12  57........................QATGYPVELIFQSWSYPDSPLAGSDLWAKVAPAASNTEEFAYADIVAAYGSDNFEKVDAVLFGSTNDAKILVT..... 135

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.