current user: public

If you have questions about the server, please let us know.

Query: PF03224.14; VATH_ORYSJ/2-323; V-ATPase subunit H, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst DHAELTTEQVLKRDIPWESYMANKLISGTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVFLNILRNISKEDTVEYVLALIDEMLAVNPKRAALFYDNSLSGEDIYDPFLRLLLKGNWFVQEKSCKILTQIISARPKMQNGIVPNGEASNSKSKLTSTQDVLRGLVDWLCSQLRNPTHPNCSVPTAMHCLATLLREQYVRALFVQADGVKLLIPLISPASTQQSIQLLYETCLCIWLLSFYDAAVDYLSTTRVMPRLVEVVKGSTKEKVVRVVIMSIRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGLLast
1 -91.700PF03224.14; VATH_ORYSJ/2-323; V-ATPase subunit H  ali  100  1DHAELTTEQVLKRDIPWESYMANKLISGTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVFLNILRNISKEDTVEYVLALIDEMLAVNPKRAALFYDNSLSGEDIYDPFLRLLLKGNWFVQEKSCKILTQIISARPKMQNGIVPNGEASNSKSKLTSTQDVLRGLVDWLCSQLRNPTHPNCSVPTAMHCLATLLREQYVRALFVQADGVKLLIPLISPASTQQSIQLLYETCLCIWLLSFYDAAVDYLSTTRVMPRLVEVVKGSTKEKVVRVVIMSIRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGL 322
2 -28.400PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like  ali follow..  10  1........................................SPNSDDTVLSPQE---LQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDII------RDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNA---------------------ENQRRLKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHIL--ANSISDFFRLF----SAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKEYKEVILKLLIIFENINDKWEENEPAQNHFSEGSLFFFLKESRHDFQVRVKVG...... 254
3 -23.100PF05804.12; KIFA3_HUMAN/13-720; Kinesin-associated protein (KAP)  ali follow..  12  252........................................................TFKKYQGLVV-KQEQLLRVALYLLLNLAEDTRTELKMR------NKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVE-------------------MDIVEKLVKMIPCEHED--LLNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALL------GNDNYKQIAMCVLYHISMDDRFKSMFAYTDCIPQLMKMLFECSDERIDLELISFCINLAANKRNVQLICEGNGLKMLMKRALKF-KDPLLMKMIRNISQ.. 480
4 -22.600PF17741.1; A0A151PBS4_ALLMI/1-268; Family of unknown function (DUF5578 topsan)  ali follow..  14  2................................................................................................TSAKEQAAIGRLLAFLQEWDNAGRAARSRILDNFIEANQGKMGPELELEF-------SQGASLFLARLTAWLRLSYMN-GTCLDQLLKAIGIFLSAASGHRYLIEFLEVGGVLTLLEILG--LSQLKEEDKKESIKLLQLVA-GRKYKELICESYGVRSIAEFMASSKSEKAQRQVQILLDSLGHGNPKYQNQVYKGLIALLPC------TSPHAQQLSLQTLRVV 212
5 -18.700PF17822.1; G3S7I6_GORGO/1-229; Family of unknown function (DUF5584 topsan)  ali follow..  58....................................................................................................................................................................IVVLGQVLMNESLPIEKRAQAAQKIGLLAFTGGPPAGNFAAEYMEEVAHLLQ--DEELAPKIKILLLQSVACWCYNPVSQKRAKSLQFIPILISFFEGRFESTLKFWTCYVLSVMTNNLSCVKELKDHSALKYHLQMLAAENWSGWTENFAEVLYFLI 225
6 -15.000PF10508.9; A7SP09_NEMVE/2-505; Proteasome non-ATPase 26S subunit  ali follow..  10  1.....................AAEKCK----ELVENISNASGDEIVAFLRDLSVLISERLFNCLRT-TNTDQITYCKNILKNILKFEKPDAPA--------TKYHDAVIEGLNHPTEDVRELCLIELERCSGTVNGVLALMDK------------------EDLLSYIARGMA--DEHLKNAQIASNVFTNLAKHEAGLKVLFDSHLQSEFNALL-----KTKDTVRMRVYDMYITVAHSPKAFDVCKESGIFEKLISELD-GRDVLVQMNCLELLTKLASSPSGLEYLDQKGVVTKLNNLLLEVETDPLITLIIPGIIKFF 278
7 -12.200PF04063.14; K9FP34_PEND2/93-278; Domain of unknown function (DUF383 topsan)  ali follow..  13  4...............................................................................................................................................................................NPKEPNADEVAMLLANLAKSEKLHNLFSLKRAIDQLMDCFVKGAEGNKYANYDYLSYLFADLSQTEKGRAYFTQRQGVVPITKLTVFTEHKSDIR-VASTIKNVAFEIESHPMLFDEDGANLLPYLLPEELSEEDMLPDLQLLPPD. 175
8 -12.000PF11698.8; K5XHD3_AGABU/314-430; V-ATPase subunit H  ali follow..  11  3TTYDEYTSELASGHLSWTPVHESDEFWKENAVKLN---------------DKEHEQLKKLINLLRSSDDPNILAIAANDVGQYVKHYERGKKFVTDM-----GGKDRVMELMAHTNPEVRYRALLSVQQLVSQS............................................................................................................................................................................................ 116
9 -11.500PF08045.11; E9DYC2_METAQ/1-287; Cell division control protein 14, SIN component  ali follow..  14  73...........................................................................................................................................................................................AFREFFKLQEGFEWNVAMRLIRTLDRLMAKGSDGQNDLLILSALDLIQGVLLHPPSKTLFSREQNMNLLLDLLEPFNCPAIQSATLLTLVVLIDTPSNTRTFEGLDGLLTVTSLFKSRSTSREVLKLVEFLYCYL 210
10 -10.700PF16782.5; J8Q2G5_SACAR/122-421; Nucleotide exchange factor SIL1  ali follow..  1........................................................................................................................................................DDYEFSNDFKEIRSIFDSHSTLSSHDITVLEDKFDNVMEFAHDYKHGYKIIVHEFPLLANVSLN---ENLSLTLRELSTRVI-CMRNNPPVVEFIDERGFKGQVILALSHKFSNILIKRYLSILNELPVTSQDLPIYSTINLQNVY----QRNGKDKQLQIKVLELISKI 172
11 -10.100PF11841.8; W4Z9X2_STRPU/133-288; Domain of unknown function (DUF3361 topsan)  ali follow..  13  4.......................................................................................................................................................................................................QDFISNHGIELLVKMVEEGSQNGE--PLSLTLKSFIELMDHNVISWDSLSANYVKKIASFVNRSSGLDVTERALNILESSILNSTKLYNVIANEIHNMTQHLENV--QNPGIQQNCLALMNAL 126

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.