current user: public

If you have questions about the server, please let us know.

Query: PF03364.20; Q82RS2_STRAW/11-133; Polyketide cyclase / dehydrase and lipid transport, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst IEAPVAVTWALWSDVSRWPSFLSHVRLVEPLDERRFAWQLSLPGADKNFVAELTEVIPGDRIAWQTTEGVHHAGVVTFHRLSDTSSRVTLQIEYDPKGFVEHIGALTNLDSTLANYDLGEFQKLast
1 -79.800PF03364.20; Q82RS2_STRAW/11-133; Polyketide cyclase / dehydrase and lipid transport  ali  100  1IEAPVAVTWALWSDVSRWPSFLSHVRLVEPLDERRFAWQLSLPGADKNFVAELTEVIPGDRIAWQTTEGVHHAGVVTFHRLSDTSSRVTLQIEYDPKGFVEHIGALTNLDSTLANYDLGEFQK 123
2 -45.900PF10604.9; A0K021_ARTS2/1-141; Polyketide cyclase / dehydrase and lipid transport  ali follow..  12  10SPLGAEEAFNYLSAFEHTAEWDPGTPVVKKLSEHRYHAEAEFRGKRQTLIYEVVELTGNHIKLRGENKTVISEDSIDVSPDGTG-CTVQYTAEFQLKGALRLIEPFMKAFMSLRDPAMNGLKS 138
3 -22.400PF11687.8; C9A4G1_ENTCA/1-119; Domain of unknown function (DUF3284 topsan)  ali follow..  13  7LSIPANVFYDQIMDSVIFDVRKATGKTLSRKQLAGFQYV-KEFSTTSRAKIEIEEIIENQVYQFKTETT-EFVARYEVAPLDEKSSKVIYTETMKSHGFMQQL.................... 109
4 -22.300PF06240.13; Q92SJ5_RHIME/5-145; Carbon monoxide dehydrogenase subunit G (CoxG)  ali follow..  13  5IAADRDAVWRGLNDADILKRCIPGCQSLELISPTELAAVVKIKSASFNGTVVLSNLNPPASYTISGEGKGGIAGFAKGGLDEGAETVLRYDVKAEIGGKLAQLGSVDSTARKLAQQFFADFNL 138
5 -17.200PF08327.11; Q92SK6_RHIME/22-158; Activator of Hsp90 ATPase homolog 1-like protein  ali follow..  11  1.DAPREKVYRAFTEAELLKQWFATEAELDVRAGGTNRFVMRSPGELYPNQGVYLEVVPNEKIVVTPSEKPFMTAVMTFENEG-GKTRYTARALHWSVEDRDAHEKMG--FHEGWGQCADQLAT 134
6 -15.500PF00407.19; Q9FYJ0_ARATH/2-150; Pathogenesis-related protein Bet v I family  ali follow..  12  12LNGSAEKHYKLWSSETHIPDTIGHIQGVILHEGD-KTWKYNLDGKEEEFKERTEIDEEKMAVTMTALDG-VYIPNLQFIPESQNACVCKVSVKWEPAKFYKFLEKMIADSDDHILHN...... 149
7 -13.200PF08982.11; G3JAQ2_CORMM/6-155; Domain of unknown function (DUF1857 topsan)  ali follow..  7VNPSAAQVWEGLRRKIRHADFVPLITSCVVEKEESNVVHRRVAFEGSKEMTEVCTELAPHKVEFRLEDGTEIENILPGPSGGPSDLYLTYSFKWKFPKIEQGSQEQQTMALGAVQSTIKVIRE 145
8 -10.500PF10698.9; R7Y137_9ACTN/10-159; Protein of unknown function (DUF2505 topsan)  ali follow..  15  4.GTTIEQVLAMYADPAFREEVATYQRAVRSSAELDGVFARKLVGDEIAIVQEETWTSDTHADVRVTIPGGDMSGTFDLAQVGDD-VVETVALTVKV-----NIPFVGGKVEDLIAGLLAK... 137
9 -8.760PF11485.8; F4B421_ACIHW/1-134; Protein of unknown function (DUF3211 topsan)  ali follow..  16  9TKHESNALLVVLSDPS-LPNLLPPIKEVK-ISEGKYTCKGKFLGMPFEIVGNYYLSTEGR-IKYVFTINKGGTGNLEFLIEQG---KVTLIFDYDGWFEKISRLFISRWINDFKKNRLKRIES 132
10 -6.550PF12723.7; Q9RSW5_DEIRA/8-144; Protein of unknown function (DUF3809 topsan)  ali follow..  15  9...GQAAALAFVREPAAALAGVRFLRGLDSDGEGELLVTVPLLGVDLPFRSEIVRTPQGAELRPLTLTGERAWVAVSGQATAAEGGEMAFAFQFQPEAEGWGGAAFEKMVQAAAGRTLERVAK 137

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.