current user: public

If you have questions about the server, please let us know.

Query: PF03446.15; Q8FTI1_COREF/15-184; NAD binding domain of 6-phosphogluconate dehydrogenase, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst QIGVVGLAVMGSNLARNFARNGHTVAVYNRSTDKTDKLISDYATDGNFIPTKTVEDFVAALEKPRRAIVMVQAGAATDAVINQLADAMEEGDIIIDGGNALYTDTVCREKEMAARGRHFVGAGISGGEEGALNGPSIMPGGPKESWEALGPLLESIAAKVDGVPCVTHIGLast
1 -77.700PF03446.15; Q8FTI1_COREF/15-184; NAD binding domain of 6-phosphogluconate dehydrogenase  ali  100  1QIGVVGLAVMGSNLARNFARNGHTVAVYNRSTDKTDKLISDYATDGNFIPTKTVEDFVAALEKPRRAIVMVQAGAATDAVINQLADAMEEGDIIIDGGNALYTDTVCREKEMAARGRHFVGAGISGGEEGALNGPSIMPGGPKESWEALGPLLESIAAKVDGVPCVTHIG 170
2 -36.600PF07991.12; ILVC_METAC/15-178; Acetohydroxy acid isomeroreductase, NADPH-binding domain  ali follow..  15  5TIAIMGYGSQGHAHARNLHESGLNVVVGLRKGSSSWAKAESDGLK-----VMTVEEAAKAADVIMILLPDEKQASVYYSQIAGNALVFAHGFNIHYNQIVPPKDVDVFMVAPKGPGHIVRRTYTEGIGVPGL--IAVYQDATGKARDLALAYAKGIGA............ 160
3 -16.100PF01210.23; GPDA_COXBU/7-162; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus  ali follow..  13  1PIAILGAGSWGTALALVLARKGQKVRLWSYESDHVDEMQAEGVNNETLKAYCDLKASLEGVTDILIVVPS----FAFHEVITRMKPLIDAKTRIAWGTKGLAKGSRLLHEVVATVPMAVISGPSLATEVAANLPTAVSLASNNSQFS....................... 156
4 -14.600PF03721.14; UGDH_CAEEL/10-205; UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain  ali follow..  14  2KVVCVGAGYVGGPTCAMIAHKCITVTVVDMNTAKIAEWNSFAARGRNLFFSSDIPKAIAEADLIFISVNTPPDLKYVESVSRTIAQYAGGPKIVVEKSTVPVKAAESIGCILREAQ---LKFQVLSNPEFLAEGTAVLIGGEPEGLQAVAELVR................ 195
5 -13.800PF00670.21; SAHH_DICDI/191-351; S-adenosyl-L-homocysteine hydrolase, NAD binding domain  ali follow..  14  25VAVVAGYGDVGKGCAQSLSKMGARVLVTEIDPINALQACMDGYQIVTMETAAPLSNIFVTTTGCRDIV-------------GEHFAVMKEDAIVCNIGHFDCEIDVAWLNANAKK....................................................... 127
6 -13.300PF10727.9; Q743Y6_MYCPA/8-128; Rossmann-like domain  ali follow..  16  6KVGIISAGRVGTALGVALERADHVVVCSAISHASRQRA----QRRLPDTPVATPPEVAAGAE----LLLLAVPDSELAGLVSGLAATVRAGTIVAHTSGA---NGVGILAPLTRQGC..................................................... 114
7 -13.200PF02558.16; Q9K9R6_BACHD/6-154; Ketopantoate reductase PanE/ApbA  ali follow..  13  1.VAVIGSGSIGLLLYAYLKLANWPALLVTNRPEQADHLNKEGLTFVAKSGEHQPISVTATPLSSFSVGFITVKSFAVKALLPQLQRKKWDGLVFFQNGMTHLEILRQIPARAICCGIVEIGAKRESDVRVQHTGDGAIWIGD............................ 146
8 -12.100PF02254.18; Q92CZ9_LISMO/5-120; TrkA-N domain  ali follow..  18  1.FAVIGLGRFGGSICRSLVEQGMEVLAIDSDEERVNEYMSIATHA--VIANSTDENALRQLGIRNFEHVIVAIGEDIQSSILTTLILKEMGVKYV----TAKATNDKHAKLLDKIGADRVVHP............................................... 116
9 -12.100PF01262.21; Q9S227_STRCO/141-353; Alanine dehydrogenase/PNT, C-terminal domain  ali follow..  17  30RAVVIGGGVSGWNAAQIAIGLGFHVTLLDKDITKLREADKIFGTKIQTVVSFELEKACLEADLVIGAV-LIPGAKAPKLVTNELVSRMKPGSVLVDGCFEDSHPTTHAEPTFPVHNSVFYCVANMPGAVPNTSTYAL---------NATLPYIVELADR........... 187
10 -11.900PF03807.17; Q21544_CAEEL/2-98; NADP oxidoreductase coenzyme F420-dependent  ali follow..  15  1KIGFIGAGKMAQALARGLINSGRNIIASSPKRDEVFLDQC---KALGLNTTHDNAEVVQKSD----VVFLAVKPVHVSKVASEIAPALSKEHLVVS.......................................................................... 93
11 -11.700PF02826.19; Q98GE4_RHILO/107-283; D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain  ali follow..  12  41.IGIVGLGAVGQAVGHIAAHGDLKVVATTRSMQPAPEKVG----------FLSIDALVEQSDIIVLCCPLTPETRGLISRER--IARMKPNALLINVSRGPVVDDDALIEALREGRIGGAALDV.............................................. 152
12 -11.500PF02737.18; Q2YR99_BRUA2/5-183; 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain  ali follow..  14  1TVGIIGAGQMGSGIAHVCALAGYNVLLHDAAPDRLEK-LQEEQRADAMKLIRPANSMEDLAGVDLAIEAATEDETIKRKIFAQLCPVLNPEAILATNTSSISITRLASTTDRPERGIHFMN................................................. 139
13 -11.000PF00899.21; SAE2_HUMAN/11-443; ThiF family  ali follow..  12  9RVLVVGAGGIGCELLKNLVLTGFHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNV-EFFRQFILVMN-ALDNRAARNHVNRMCLAADVPL----IESGTAGYLGQVTTIKKGVTECYECHPK................... 154
14 -10.600PF05221.17; D9SB20_FIBSS/15-498; S-adenosyl-L-homocysteine hydrolase  ali follow..  11  258IAVVCGYGDVGKGCAQSLRGQGARVIITEIDPICALQAAMEGYEVKTLDEVVSYADIFVTTTGNTGIISAAQ------------MEKMKNRAIVGNIGHFDNEIDMAGLKKIPGIKRNEIKPQYDEWIFADGHSILVLAEGRLLNL........................ 391
15 -10.400PF13460.6; G2TRC2_BACCO/7-191; NAD(P)H-binding  ali follow..  2.....ANGKIGKILVDLLQKSDRHIRAMVRKEEQAQFFRQKGVDAVLS--LEGTDELAEAAKGCDIVFTAGSGGHTDKTLAVKTMEAAEKAGIFMIVSALQANHREYADRVLQSTKLNYTIIRPGGLLNDPGTGKIEASENLKRGTIPREDVARTILASLD......... 172
16 -10.000PF01488.20; HEM1_PSEAE/169-304; Shikimate / quinate 5-dehydrogenase  ali follow..  14  14QALLIGAGETITLVARHLFEQGVRIVVANRTLERASLLAEQ---GAHAVLLSEIPEELANSDIVISSTASQLPILGKGAVERALKQRKHKPMFMVDIA---PRDIEPEVGELDDVYLYSVD................................................. 131
17 -10.000PF02153.17; TYRA_BACSU/20-279; Prephenate dehydrogenase  ali follow..  15  2............ALAIKKNHPGKRIIGIDISDEQAVAALKLGVIDD---RADSFISGVKEAA---TVIIATPVEQTLVMLEELAHSGIEHELLITDVGSTK-QKVVDYADQVLPSRYQFVGGPMAGSHSGVAAAKEFLFENDKQAVEQLKNLLKGTNAHFVEMSPEEH.. 163
18 -9.860PF00389.30; Q9KCG9_BACHD/20-325; D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain  ali follow..  10  137.LGIIGFGRIGSQIAKRAKAFEMTPYVFD-------PFLTKARAEKLGVTVASLDDVLQVADIITVHTPLTKETKGLLGMKN--IGKTKKGVFLINCARGGIIDEEALKHYLREGHIAGAALDV.............................................. 250
19 -9.780PF10100.9; H6NF63_9BACL/6-429; Staphylopine dehydrogenase  ali follow..  11  2RVLILGTGPASVQLAVTLKNKWNCIGIAGRESVRSEPFFTALDESGRRVRADIQNEKHQAMQGECIVDHVFQGYGTITGEWDTL--------ILAVTTDAYVAVLKQIHGELLKRVRCML---LSPTFGSNRLVRHYM................................ 130
20 -9.330PF16924.5; D3E6N7_GEOS4/7-123; Dipicolinate synthase subunit A N-terminal domain  ali follow..  10  3...FVGGDARQIEVIRKCAEMDASVMIAG--------FEKLQDSFQGVTREPLTPELLSDADALILPVVGCDDEGRVSALQEEHIAAMPGHGVIYTG-----MAKPYLRSLCDKYKIKLVE................................................. 115
21 -9.230PF05368.13; NMR1_NEUCR/67-329; NmrA-like family  ali follow..  1.IAVINAGRQAASFIRVATAVGFHVRAQMRNLEVATEVSTNPNVTVLQGELYTKETPAESDKGQCVDVTKNGPISGIGVNDALISELFRGAQINTTFYGDEERIGMALADAAKKAGVQHYVYSSMPDHHAYNKDWPSLPLWASKH--RVEDYVKEIGIPATFVYTGIYN. 172

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.