current user: public

If you have questions about the server, please let us know.

Query: PF03494.13; I3KA26_ORENI/598-636; Beta-amyloid peptide (beta-APP), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .
# Score Template Links and tools%idFirst ERQSAGYEVYHEKLVFFADDAGSNKGAIIGLMVGGVVIALast
1 -39.900PF03494.13; I3KA26_ORENI/598-636; Beta-amyloid peptide (beta-APP)  ali  100  1ERQSAGYEVYHEKLVFFADDAGSNKGAIIGLMVGGVVIA 39
2 -6.730PF13067.6; C2W7U0_BACCE/1-51; Protein of unknown function (DUF3930 topsan)  ali follow..  36  2...DYQYEVEQRKEEFVHEDKWADKGLIIFLTIVGI... 37
3 -5.170PF00858.24; B4J8N8_DROGR/25-498; Amiloride-sensitive sodium channel  ali follow..  24  431..RESAYYGTMTNVYIGFTEFLSNIGGVMGLFLGFSVIS 467
4 -4.980PF06380.11; A5A2Q5_BYDVP/1-39; Protein of unknown function (DUF1072 topsan)  ali follow..  23  3.......DLHVIAVCIFALTVLTGLGAVIGCCAGCLL.. 32
5 -4.850PF11346.8; D7DQE2_METV0/4-43; Protein of unknown function (DUF3149 topsan)  ali follow..  31  4...............LFSTDYGLQSLAVIVFILGMCV.. 25
6 -4.820PF17413.2; B9K412_AGRVS/18-52; Outer membrane lipoprotein virB7  ali follow..  35  1.................SDQLATSKGPVFPLNVG..... 17
7 -4.740PF04689.13; K4CQD9_SOLLC/15-80; DNA binding protein S1FA  ali follow..  31  2.................VEVKGFNPGLIVLIVVGGLLLT 23
8 -4.480PF16648.5; A0A1D5PLJ8_CHICK/576-642; Unstructured region on Calpain-3  ali follow..  42  18...........KPIIFVSDRANSNK.............. 31
9 -3.750PF05750.11; POLS_RUBVT/1-300; Rubella capsid protein  ali follow..  20  263ERIETRSARHPWRIRF-----GAPQAFLAGLLLATVAVG 296
10 -3.710PF11879.8; W5KP37_ASTMX/443-542; Domain of unknown function (DUF3399 topsan)  ali follow..  16  27.KTSSLLESQHHHLLHCLEKTTAHE.............. 50

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.