current user: public

If you have questions about the server, please let us know.

Query: PF03730.14; F7E5D3_XENTR/470-557; Ku70/Ku80 C-terminal arm, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst NFRSDSFENPVLQQHFRNLEALALDMLEPEPIEDLTLPKVEMIDRRLGTLVEEFKELVYPPGYNPEGKAVKRKQAGDSDSRAEKKAKALast
1 -57.400PF03730.14; F7E5D3_XENTR/470-557; Ku70/Ku80 C-terminal arm  ali  100  1NFRSDSFENPVLQQHFRNLEALALDMLEPEPIEDLTLPKVEMIDRRLGTLVEEFKELVYPPGYNPEGKAVKRKQAGDSDSRAEKKAKA 88
2 -6.940PF11944.8; Y2971_PHOPR/1-125; Protein of unknown function (DUF3461 topsan)  ali follow..  14  73........NRTLTHIIDELDIITKRKHTEVDIKKKILGDLRHLERVVSHKISEIEADL.............................. 122
3 -6.100PF06875.11; Q5BNQ4_9SALA/2-215; Plethodontid receptivity factor PRF  ali follow..  14  107..........FYSAIVEFLKEAMTEQEDLNPAELALKAKFEEAMANSNTLISKISDIMTQMGMSVTITLPKPLVVPFKGSAYFSKK.. 182
4 -5.700PF11179.8; A0A0R3NSG9_DROPS/88-947; Protein of unknown function (DUF2967 topsan)  ali follow..  639.FDREALDHERIQR-----ECFARSSSTASASSDSDEAENRSVYER-ADIFQQYSRLTQQEQLQQQQQQREWERDRPPSRKNSKRIR. 721
5 -5.690PF13764.6; Q0IES4_AEDAE/4420-5222; E3 ubiquitin-protein ligase UBR4  ali follow..  14  348....EFISRASLKYILRFLTGLATKHEATQLVAKDIIPIIHRLEEHVGSLAENLLEALCTEPVTAKRVQEVRDFTRAEKKRLAMATR. 436
6 -5.360PF18803.1; S8EAN7_FOMPI/84-191; CxC2 like cysteine cluster associated with KDZ transposases  ali follow..  14  61RLFPATRIDPKTASTFRLMEHYHLLHNQTKVSGYEFYNTLARRTDNLG........................................ 108
7 -5.340PF02862.17; B2ADZ4_PODAN/611-953; DDHD domain  ali follow..  89.SDPIAYREPLISQAMSTLKPQALPYTKKTIFGSVAPQGLTGLGAKVGQSVTGLWSSFSAGIASSLLNRSLGLTQEDVNNINASHHRE 176
8 -5.250PF08532.10; Q5WC61_BACSK/410-615; Beta-galactosidase trimerisation domain  ali follow..  15  31..........QVQSHYRSFWKHGVPVDVVSMNDDIVAPMLYMLKPGVAEQIEAYVK................................ 82
9 -5.170PF05884.12; A0A2H2IWJ2_CAEJA/19-303; Interactor of ZYG-11  ali follow..  13  1.........PAL--------ANADGQEAGRAGIHLAVNTMQKFGRELEQFPIESKKLMEQVLSSVSSVNMATAASTRGSRSEASQDSF 72
10 -5.140PF10557.9; H3F5G1_PRIPA/715-777; Cullin protein neddylation domain  ali follow..  19  13...........IMKARKTLQHNDLVVEVTEQLQSRFKPDPQLIKMRIESLIER................................... 54

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.