current user: public

If you have questions about the server, please let us know.

Query: PF03771.16; F2R998_STRVP/39-107; Domain of unknown function (DUF317 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst LSPRGLAGAEWVRGSHDFLLGDLQVAWHVSARQHPSSAVMEWTACFTTGTPPEAIADFLLAIEARTDPALast
1 -58.300PF03771.16; F2R998_STRVP/39-107; Domain of unknown function (DUF317 topsan)  ali  100  1LSPRGLAGAEWVRGSHDFLLGDLQVAWHVSARQHPSSAVMEWTACFTTGTPPEAIADFLLAIEARTDPA 69
2 -7.340PF14955.6; T1KQU9_TETUR/46-179; Mitochondrial ribosome subunit S24  ali follow..  12....................RTNPVTYEEIHPPHFIAVRKGFNSLNTSNLLAGTRSGETAIEDM..... 55
3 -7.130PF13053.6; Q81Q33_BACAN/1-89; Protein of unknown function (DUF3914 topsan)  ali follow..  11  31........LESKKVNDPIKFDIRSSEKEMKQPEHKFNELDLWKMLKDKGVPLWIILEMLQKVRKEKE.. 89
4 -6.290PF11274.8; C4JKC3_UNCRE/128-343; Protein of unknown function (DUF3074 topsan)  ali follow..  29  174....................NANPVEWIMITRSDPGGNIPRWMV--EKGTVPSIIADAKKFID...... 214
5 -6.280PF14323.6; H1XSQ7_9BACT/292-520; GxGYxYP putative glycoside hydrolase C-terminal domain  ali follow..  12  35....................SKAKLGWTISPALSELAP-TVMKYIYDRADATNAGRDYFIA........ 74
6 -6.010PF03393.16; MATRX_HRSVB/1-252; Pneumovirus matrix protein  ali follow..  17  18........................VQYNVLEKDDDPASLTIWVPMFQSSVPADLLIKELASIN...... 56
7 -6.010PF00810.18; A0A0D2VV35_CAPO3/28-169; ER lumen protein retaining receptor  ali follow..  19  91........................LLWTVSIYLESVAIMPQLWMIQKTGEAESVTSHYLFALGAYR... 132
8 -5.880PF04559.12; A0A1P7U0A2_9ALPH/1-696; Herpesvirus UL17 protein  ali follow..  16  61.......................PIPVSVQMRYNATGKCSGWRESPAAYVPSGALHILLI......... 97
9 -5.660PF03781.16; SUMF2_PONAB/26-292; Sulfatase-modifying factor enzyme 1  ali follow..  19  126...DARAYCAWRGKRLPTE-----EEWEFAARGGLKGQVYPWGNWFQPN.................... 166
10 -5.570PF09197.10; G0WD26_NAUDC/524-655; Rap1, DNA-binding  ali follow..  49.TMDPNHIPGSEPGFKEYKVNDRK-FFKSFADENPTHTENAWRDRYRKFLLTFGVDAYIAYYEIERASG 121

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.