Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF03989.13; GYRA_HAEIN/641-686; DNA gyrase C-terminal domain, beta-propeller, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
# Score Template Links and tools%idFirst KFVVMATAGGIVKKIALTEFSRPRSNGIIALNLRDEDELIGVDITDLast
1 -36.300PF03989.13; GYRA_HAEIN/641-686; DNA gyrase C-terminal domain, beta-propeller  ali  100  1KFVVMATAGGIVKKIALTEFSRPRSNGIIALNLRDEDELIGVDITD 46
2 -5.670PF16663.5; MAGI1_MOUSE/202-261; Unstructured region on MAGI  ali follow..  10  13......SKQSTPKRT--KSYNDMQNAGIVHPENEEEEDVPEMNSS. 49
3 -5.250PF05345.12; Q83FH2_TROWT/534-594; Putative Ig domain  ali follow..  5  24..LSLNPNTGTISGTVASTGDEIPASGTYSFRVIAVSL........ 59
4 -5.050PF18229.1; A0A139NSU5_9STRE/3-81; N-acetyl-beta-D-glucosaminidase N-terminal domain  ali follow..  11  37..IRVTGQEGHYQVAYDQPHRLYRALALLAAALQSGETVVSIQET. 79
5 -4.610PF16824.5; M4X010_9PSED/342-464; C-terminal carbohydrate-binding module  ali follow..  11  52..NTIWYMNGRREQLKIEQSKAVDTGGRYVFELRND.......... 85
6 -4.470PF16248.5; H1Y975_9SPHI/21-103; Domain of unknown function (DUF4905 topsan)  ali follow..  19  47...IEACYNGVLFLHGYESALSPAHKGLIAIDGVTGITL....... 82
7 -4.430PF11347.8; K9RDM3_9CYAN/7-68; Protein of unknown function (DUF3148 topsan)  ali follow..  12  20..MPMLRPPDIINVGEEGIVLDRRPGGYWGIRFAKGAFLLDSQ... 60
8 -4.360PF16166.5; B9RW66_RICCO/121-295; Chloroplast import apparatus Tic20-like  ali follow..  20  86..YYYIALLGVVKNKQVPHF--FRFHLMMGMLLE............ 115
9 -4.000PF14217.6; D4ZXQ7_ARTPN/8-74; Domain of unknown function (DUF4327 topsan)  ali follow..  19  13.....LLHKGMISRQQLCQYIPAREWACIEYELEAFNFLLRDRIGD 57
10 -3.900PF01336.25; TIAS_METAC/272-345; OB-fold nucleic acid binding domain  ali follow..  21  18.HVIFAVRDGKGDEIDCAAFEPTKNFRVLARRLLLGDQI....... 55
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Schwarzenbacher R, Godzik A, Jaroszewski L. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches. Acta Crystallogr D Biol Crystallogr. 2008 Jan;64(Pt 1):133-40. Epub 2007 Dec 5.