current user: public

If you have questions about the server, please let us know.

Query: PF04063.14; K9FP34_PEND2/93-278; Domain of unknown function (DUF383 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst KLTNPKEPNADEVAMLLANLAKSEKLHNLFSLKRRIPESVSTSENAIDQLMDCFVKGAEGNLNKYANYDYLSYLFADLSQTEKGRAYFTQRQEYDGVVPITKLTVFTEHKSDIRRKGVASTIKNVAFEIESHPMLFDEDGANLLPYLLLPLAGPEELSEEDTADMLPDLQLLPPDKQRDSDTSIITLast
1 -98.900PF04063.14; K9FP34_PEND2/93-278; Domain of unknown function (DUF383 topsan)  ali  100  1KLTNPKEPNADEVAMLLANLAKSEKLHNLFSLKRRIPESVSTSENAIDQLMDCFVKGAEGNLNKYANYDYLSYLFADLSQTEKGRAYFTQRQEYDGVVPITKLTVFTEHKSDIRRKGVASTIKNVAFEIESHPMLFDEDGANLLPYLLLPLAGPEELSEEDTADMLPDLQLLPPDKQRDSDTSIIT 186
2 -13.100PF05804.12; KIFA3_HUMAN/13-720; Kinesin-associated protein (KAP)  ali follow..  14  259.LVVKQEQLLRVALYLLLNLAEDTRTELKMRNKN-----------IVHMLVKAL------DRDNFELLILVVSFLKKLSIFMENKNDMVEMD------IVEKLVKMIPCEHEDLLNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALL...................................... 382
3 -12.200PF03224.14; VATH_ORYSJ/2-323; V-ATPase subunit H  ali follow..  13  176...THPNCSVPTAMHCLATLLREQYVRALFVQAD-----------GVKLLIPLISPASTQ--QSIQLLYETCLCIWLLSFYDAAVDYLSTTR---VMPRLVEVVKGSTKEKVVR---VIMSIRNLLAKGAFAAQMIDLGLPHIVQNLK-----AQAWTDED---LLDALNQLEIG........... 321
4 -11.500PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like  ali follow..  10  63.LNTRDPIVKEKALIVLNNLSVNAENQRR-----------------LKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHILAN--------SISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLF-----NKKEYKEVILKLLIIFENINDNFKWEENEPAQ. 216
5 -9.750PF08324.11; G0NNV7_CAEBE/596-852; PUL domain  ali follow..  10  69................VLDFFR-------VALTHESLNSYFCTGERGQDLVMKIIAILVSDPADMVLKVMVCRCIGNAFAHPAGRSLFASYELSTLAPLVIRQL---LNEKQILQMSAATALANWSLSETVEQLGPKEDLLRALITGIEAVDSFGFVSEEALSRLLQTIVTI.............. 219
6 -7.830PF04869.14; G1XLW2_ARTOA/333-629; Uso1 / p115 like vesicle tethering protein, head region  ali follow..  14  105...........FSGAIFMTLISENQEARDIAMTSGDVESGEEVVTAIQTFSGNLVAALDHSLDPRICLTFLMALSVWLYENPLAVNDFLNEGAT-----IESLLRIVNDQSNKD-QGMCTFLIGVVYEFSSADSPLSRDA---LKDRIVARIKKDQY............................. 246
7 -7.540PF17741.1; A0A151PBS4_ALLMI/1-268; Family of unknown function (DUF5578 topsan)  ali follow..  10  116...QLKEEDKKESIKLLQLVANAGRKYKELI----------CESYGVRSIAEFMASSKSEKAQRQ-----VQILLDSLGHGNPKYQNVQAIVGKSHPSIVEAVLGVLRSMELEVQYEAIQLIKDLTSYDVRPALL--------LVALLKP.................................... 268
8 -6.880PF10508.9; A7SP09_NEMVE/2-505; Proteasome non-ATPase 26S subunit  ali follow..  12  134.MADEHLKNAQIASNVFTNLAKHEAGLKVLF-----------DSHLQSEFNALLKTKDTVRMR-------VYDMYITVQAHSPKAFDVCKESG-----IFEKLISELDGRDVLVQMNCLELLTKLASISPSGLEYLDQKG--VVTKLNNLLLEVET.............................. 263
9 -6.010PF11701.8; F6ZSU7_XENTR/243-434; Myosin-binding striated muscle assembly central  ali follow..  33KILEVGGSLVEFPGSLSVT-ESTRMSASVLLNKLFDDLKCDAERENFHKLCEDYVRSLFEGHGMDGKLRSIQTVSCLLQGPSEAGNRTLELTG-----IMESIISLCASEREIDQQVAVEALIYAAGKAKRAS-FITANGVALLKDIY...................................... 173
10 -6.010PF03015.19; E2BCH8_HARSA/376-469; Male sterility protein  ali follow..  12  1...................................................................LHVLPAFVLDLIIRIQGGKPIMMKIVKRLERAAQTGEFFAMNEWKFYSGNMTELLKFVTASKDCSDFNLDFRNLDWDAYLHQYMLGIRKYIFRD......................... 94

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.