Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF04210.13; Q12VV0_METBU/7-70; Tetrahydromethanopterin S-methyltransferase, subunit G, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
# Score Template Links and tools%idFirst TTPSVVTDPVDFNEVLEKLNLIDEKIEFVNSEIAQRIGKKLGRDIGIMYGAVAGILIFLIYISLLast
1 -45.100PF04210.13; Q12VV0_METBU/7-70; Tetrahydromethanopterin S-methyltransferase, subunit G  ali  100  1TTPSVVTDPVDFNEVLEKLNLIDEKIEFVNSEIAQRIGKKLGRDIGIMYGAVAGILIFLIYISL 64
2 -7.310PF05644.11; A8E7S0_DANRE/12-286; Mitochondrial and peroxisomal fission factor Mff  ali follow..  13  221......AGLTDAASLRRQIIKLNRRLQLLEHENKERAKREM-----VMYSLTVAFWLVNSWIWL 273
3 -6.660PF16080.5; J7U231_MORMO/5-60; Bacteriophage holin family HP1  ali follow..  14  1...................DKYSSPTAYAWGLITSAFGILSLDQWAIVAGIICTVGTFLV.... 41
4 -6.540PF06837.11; VP92_FDVS/1-207; Fijivirus P9-2 protein  ali follow..  20  45............SELDDKVDDLEIKIEKVSGPLLNRYLGSVGKVVFLIFSFL............ 84
5 -6.310PF04286.12; B2JUN1_PARP8/44-418; Protein of unknown function (DUF445 topsan)  ali follow..  18  326..............ISDTVKNWDSR------DMSQQIELNIGKDLGTLVGGCIGLLLYVSSQLF 375
6 -5.940PF15205.6; G1M2V3_AILME/33-106; Placenta-specific protein 9  ali follow..  21  18.........DRYMAVHDRLDVIEETVEKTVEHLEAEVKGLLG...................... 50
7 -5.800PF02535.22; ZIP1_ARATH/48-352; ZIP Zinc transporter  ali follow..  31  222................................VTAPLGIGIGLGMGMLNAASAGILIYMSLVDL 270
8 -5.730PF09548.10; A9KMD0_LACP7/8-175; Stage III sporulation protein AB (spore_III_AB)  ali follow..  19  122........DMQMNHIDWYITQVEEDMQEINLDAKEK--IRLYRSLGVLLGIFVTILV....... 168
9 -5.620PF08560.10; G0NUG4_CAEBE/10-151; Protein of unknown function (DUF1757 topsan)  ali follow..  13  91.............ILYGKCYSLRFDEDALRRDRAAVFSAAAGYLSSGAPGFVIGLDVSFLFSKL 141
10 -5.430PF15103.6; U3KJL5_FICAL/1-103; G0/G1 switch protein 2  ali follow..  26  1..................METMHELIPFAKEMLSQKPNRKLGSVLAFF-GVVIGLV........ 43
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.