current user: public

If you have questions about the server, please let us know.

Query: PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst SPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKEYKEVILKLLIIFENINDNFKWEENEPAQNHFSEGSLFFFLKEFQVCADKVLGIESRHDFQVRVKVGLast
1 -78.200PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like  ali  100  1SPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKEYKEVILKLLIIFENINDNFKWEENEPAQNHFSEGSLFFFLKEFQVCADKVLGIESRHDFQVRVKVG 254
2 -38.400PF05804.12; KIFA3_HUMAN/13-720; Kinesin-associated protein (KAP)  ali follow..  12  239DPENQTLRKDYEKTFKKYQGLVVKQE-QLLRVALYLLLNLAEDTRTELKMRNKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLVKMIPCEHEDLLNITLRLLLNLSFDTGLRNKMVGLLPKLTALLGNDN--YKQIAMCVLYHISMDDRFKSMFAYTDCIPQLMKMLFECSDERIDLELISFCINLAA--NKRNVQLICEGNGLKMLMKRALKFKDPLDLAAQISNDEEEEFVIECL 513
3 -31.100PF17741.1; A0A151PBS4_ALLMI/1-268; Family of unknown function (DUF5578 topsan)  ali follow..  10  52..SQGASLFLARLTAWLRLSYMNGTCLDQLLKAIGIFLSAASGHRYLIEFLEVGGVLTLLEILGLSQEEDKKESIKLLQLVANGRKYKELICESYGVRSIAFMASSKSEKAQRQVQILLDSLGHGNPKYQNQV--YKGLIALLPCTSPHAQQLSLQTLRVVQAIVGKS----HPSIVEAVLGVLRSM-ELEVQYEAIQLIKDLTSYDVRPA--------LLRGLVALLK......................... 267
4 -28.400PF03224.14; VATH_ORYSJ/2-323; V-ATPase subunit H  ali follow..  10  41PESQRGPLLDEDGVRVFLNILRNISKEDTVEYVLALIDEMLAVNPKRAALSGEDIYDPFLRLLLKGNWFVQEKSCKILTQIISARSTQDVLRGLVDWLCSQLRNPTHPNCSVPTAMHCLATLLREQYVRALFADGVKLLIPLITQQSIQLLYETCLCIWLLSFYDAAVDYLSTTRVMPRLVEVVKGSTKEKVVRVVIMSIRNLLA--KGAFAAQMIDLGLPHIVQNLKAQ------------AWTDEDLLDALN 316
5 -25.300PF10508.9; A7SP09_NEMVE/2-505; Proteasome non-ATPase 26S subunit  ali follow..  12  1.........AAEKCKELVENI-SNASGDEIVAFLRDLSVLISSSPNIRDLASLIPSERLFNCLRTTNTDQITYCKNILKNILKFEKPDAPATKYHD--AVIEGLNHPTEDVRELCLIELERCSGTVNGVLALEDLLSYIARGMADEHLKNAQIASNVFTNLAKHEAGLKVLFDSHLQSEFNALLK--TKDTVRMRVYDMYITVQAH-SPKAFDVCKESGIFEKLISELDGRDNCLELLTKLASISPSGLE.... 243
6 -19.800PF17822.1; G3S7I6_GORGO/1-229; Family of unknown function (DUF5584 topsan)  ali follow..  13  50.....ETYFHEEKIVVLGQVLMNESLPEKRAQAAQKIGLLAFTGGPPAGNFAAEYMEEVAHLLQDEEPKIKILLLQSVACWCLNPVSQKRAKS---------------------------------------LQFIPILISFFEGRFESLKFWTCYVLSVMTNNLSCVKELKDHSALKYHLQMLAAENWSGWTENFAEVLYFLI.................................................. 225
7 -19.000PF11698.8; K5XHD3_AGABU/314-430; V-ATPase subunit H  ali follow..  23  40.........EHEQLKKLINLLRSSDDPNILAIAANDVGQYVKHERGKKFVTDMGGKDRVMELMAHTNPEVRYRALLSVQQLVSQS......................................................................................................................................................................... 116
8 -15.300PF13646.6; C3YB05_BRAFL/324-412; HEAT repeats  ali follow..  12  1.......................................................VSSLKKLLVDEDPNIRAVASIALGKTGTCTP-----------------------------------------------DIVEALVNLLKDEDRLVRESTCVSLGYLQAQD----------AVPHVINAWRNDPISHVREAAQAALR..................................................... 89
9 -14.000PF11701.8; F6ZSU7_XENTR/243-434; Myosin-binding striated muscle assembly central  ali follow..  10  1...........SALNLLMKVVPRK----SFRDPDNGMTLWVIDTGLKKILEVGGSLVEFPGSLSVTE-STRMSASVLLNKLDLKCDAERENFHKLCEDYVRSLFEGHGMDGKLRSIQTVSCLLQGPNRTLELTGIMESIISLCASEREIDQQVAVEALIYAAGKAKRASFITA-NGVALLKDIYKKNENDAIRIRALVGLCKL................................................... 192
10 -13.300PF12717.7; G8Y240_PICSO/105-271; non-SMC mitotic condensation complex subunit 1  ali follow..  12  2............................IRALAIRTMGCVRVARMVDFI------EIPLKRTLSDDNPYVRKTAAICVAKL---DLSPKACVEFGFLDQLRGLIKDSNPMVVANALNSLFEIKDMNVDSEFDSELIKTLLMCLNECTEWGRITILDTLTKYEASSSEEASHI----IDRATPQLQ-HANPSVVLSSIKVILH.................................................... 167
11 -13.000PF12031.8; C3ZM58_BRAFL/582-837; SWI/SNF-like complex subunit BAF250/Osa  ali follow..  10  9................................ISNIFRSLSFIPGNDLEMSKPGLLLALGKLLLLHHNHPERSQAVRTYEKDESEIDAVPYKREEWWWDCLE-------LLRENVLVILANIAGNMDLSIYPESISLPILDGLEKSQLSPQRLALEALAKLSILDNNVDLIQATKLNGHLVRWLGDKKQAVMREFSVVLLSNLAQGDTITCRAIACQAGSVSALIGFLEDAEATASAIAQN............. 237
12 -13.000PF14664.6; R9ABX2_WALI9/151-516; Rapamycin-insensitive companion of mTOR, N-term  ali follow..  9SFRLKYELDQSVLINGVKECLSDSAGGLVRTVAYRLLRHSLVDYSSAQLYNSYGINIYLIRSLARDSSD-KEQAVFFIRALVDLGNPHGLFIDQSIVRAIISIAENGDDSLRYFCLELLAEIAILDMELLSKSQGLNILLSALTGSLAHFAPVVASIFCYTLDHPSTRKYIKPGTDLEVSMTAFASNARIERLKCANSILVVLLKNWSGLLYFCVNDRNTVRTLIDALRVPSQELREA................ 260
13 -12.000PF16782.5; J8Q2G5_SACAR/122-421; Nucleotide exchange factor SIL1  ali follow..  1..DDYEFSNDFKEIRSIFDSHSTLSSHDITVDKFDNVMEFAHDYKHGYKIIVHEFPLANVSLNENLSLTLRELSTRVITSCMRN-----------------------NPPVVEFIDERFAGFK------GQVILALSNLNDSNHKFSNILIKRYLSILNELPVTSQDLPIYSTINLQNVYQRNG---KDKQLQIKVLELISKI................................................... 172
14 -11.800PF04078.13; S9W3M1_SCHCR/15-273; Cell differentiation family, Rcd1-like  ali follow..  12  2....................IIQIVSGTQREEALVELSRKREQYEDLALILSYGVMTALLQ-LTGPTSNRVCNALALLQCIASHPETRIHFLNAHITLFLYPFLNTLSKSLRLTSLGVIGALVKNDSPEVI-TEIIPLCLRIMENGSELSKTVAIFIVQKFLCDDVGLQYICQASVLNNMVLQLVDSFAFRLLKHVIRCYLRLSDNPRAREALRLPEPLRDATFAHVLKDDHNTKKCLAQLLIN.......... 258
15 -11.700PF08045.11; E9DYC2_METAQ/1-287; Cell division control protein 14, SIN component  ali follow..  19  126HPPSKTLFSREQNMNLLLDLLEPFNCPAIQSATLLTLV-LIDTPSNTRTFEGLDGLLTVTSLFKSRSREVKLKLVEFLYCYLMPETQRDSVPAMLQRSPSKLAGAFNAESRRKRAGSSGLVTLTTEEKQELLSRHLSSVEDLVKD............................................................................................................. 280
16 -11.600PF01602.20; Q22601_CAEEL/28-590; Adaptin N terminal region  ali follow..  10  302.............ACNQLGTFLSHRETNLRYLALESMCLLATSEFSHDAVKKHQDT-IINSLKTERDVSVRQRAVDLLYAMCDRSNANQIVAE------MLAYLETADYSIREEMVLKVAILA--EKYATDYTWYVDVILKLIRIAGDYVSEEVWYRVIQIVVNRED----VQGYAAKTVFEALQRPACHENMVKVGGILGEFGNFIAGDERSTTTRCLLLTTYIKFCNLFPEIKPLVQQVLRNPDAELQQRS. 552
17 -11.500PF04063.14; K9FP34_PEND2/93-278; Domain of unknown function (DUF383 topsan)  ali follow..  10  2..............................................................LTNPKEPNADEVAMLLANLAKSEKLHNLIDQLMDCFVKGAEGNLNKYANYDYLSYLFADLSQTEKGRAYFTQPITKLTVFTEHKSDIRRKGVASTIKNVAFEIESHPMLFDEDGANLLPYLLPEELSEEDTADMLPDLQLLPPDKQRDSDTSII...................................... 185
18 -11.000PF12530.8; D8SAX6_SELML/484-706; Protein of unknown function (DUF3730 topsan)  ali follow..  10  1.............LFSLKYHQRHDVNTNVVIAFLNALPDICGHPTTVPLS-----MHLLQHMVDKGNLRIQATSIRLIYKIQHTDRAYSFLQKT--LVPSWFSQAKEETDVLLSRATSLRDLCGHDPDV---IELILSVQACVECRSPVVKALGLQSLSFLCGH----DAIDFYTAWKVIAKLFSPLPISPSISESFCMLLKHGALDANLNAEDAHA--VLNALWEFASCDKQ--------PSEEWYRTRSAA. 219
19 -10.400PF11841.8; W4Z9X2_STRPU/133-288; Domain of unknown function (DUF3361 topsan)  ali follow..  13  4.....QDFISNHGIELLVKMVEEGSNGEPLSLTLKSFIELMDHNVISWDSLSANYVKKIASFVNRSDFQVTERALNILESSILNSTKLYNVIANEITFMTQHLENVQNPGIQQNCLALMNAL--------------------CLKAPEDRKKRFEEALSARNIRVVIMEKII.................................................................................. 156
20 -10.400PF09759.9; Q5BC22_EMENI/804-903; Spinocerebellar ataxia type 10 protein domain  ali follow..  24  1............................LKKLVVLVLSSLVKCPEVQDQIRRYGGVETILSCFDAHNPYIKEHAVMCLKFLLENRENQKLIEE................................................................................................................................................................. 69
21 -10.300PF12755.7; C4QYN7_KOMPG/59-156; Vacuolar 14 Fab1-binding region  ali follow..  14  1.............................................................................................................NSRNGGLIGLAATAIAHEVPKYLEKIIHPVLACFGDQDARVRYYACESLYNISKVAKGEILLYFNEIFDNLCKLTADSEVS--VKKGADLLDRLIKD................................................ 98
22 -10.300PF13251.6; Q29FP6_DROPS/352-529; Domain of unknown function (DUF4042 topsan)  ali follow..  13  1...........................SVRISALHLMSALTKQLPRRSLYGYWHVIHLLHLAKNDANSRCRALALQLAGQLLYGSVSLARSVMTVYRSLTSILDREYAPPVLTQCLKCLAILVQATPFDHLEMGFVYEFVLAKTGGNTPVTVAALLVMEMLVATPGLTQEM................................................................................... 178
23 -9.870PF06685.11; Q8YLB6_NOSS1/1-246; Protein of unknown function (DUF1186 topsan)  ali follow..  10  30..........EAITPILISTLDEKEDYILHIHALYLLAQ----------FREESAYPTIIKFFSVPGDVVTEDLGRILACVSGGR---------IEPIKQLIENSKANEYVRGAALEALLVLIAQEVTREQVIQYYAKLFSTLDKEDHYIQTTLVTNSAQLCAVE----------LQEQINRAFEQNSVDLFFIDQEDVSTYLVVEKEEA............................................ 219
24 -9.640PF08324.11; G0NNV7_CAEBE/596-852; PUL domain  ali follow..  10  18NEKQDAFQLSTDQINCLEELFHLATTSNYSSDVAQSAFDTALQWPVEHLAPVLDFFRVAL---DPADMVLKVMVCRCIGNAFAHPAGRSLFASYELSTLAPLVLLNEKQILQMSAATALANWSLTVEQLGPKEDLLRALITGIGFVSEEALSRLLQTIVTIMWGDSSVIRLAKNRNMAAIAARLKDATQNETTKSMAR........................................................ 256
25 -9.600PF01347.22; VIT_ICHUN/18-588; Lipoprotein amino terminal region  ali follow..  11  388.........TRESLSYARELLHTRNRPILRKTAVLGYGSLVFRYCANTVSCPDELLQPLHDLLDRADEEEIVLALKALGNAGQPNSIKKIQR----LPGQGKSLDEYSTRVQAEAIMALRNIAKRDPRKVQ-----EIVLPIFLNVAIKSELRIRSCIVFFESKPS-------VALVSMVAVRLRREPNLQVASFVYSQMR..................................................... 571
26 -9.500PF08569.11; I1JJR7_SOYBN/4-337; Mo25-like  ali follow..  123..............LDLVDMLIGEKEGDIALTYGAVARECIRHQSVARHVLESEHMKKFFDYIQLPNFEIASDAVATFKELLTRHKSTVA--DWFFKEYNSQLLESTSYFTRRYAIKLLGDMLLDRSNAAVMVDNMRILMNLLRDSNKTIQLDTFHVFKLFVANQNKPPEVVKHKLLQFLDNFNNDKADEHFQADKQQVISEIIT................................................. 332
27 -9.350PF05918.11; D7TJH2_VITVI/11-547; Apoptosis inhibitory protein 5 (API5)  ali follow..  10  2...........EKLYEYGERLNEAKDKSQNVEDYRGIIAAAKGSIKAKQL----AAQLIPRFFKF--PDLSDAAVDSHLDLCEEE----------------------ELGVRVQAIRGLPLFCKDTP--EYVSKIVDILAQLLTAEENVERDAVHKALLSLLRQDVKASL---TGLFKHIMTVDDPSTDENLREKVLNFIRDKVFPLKAELLKPQEQRHITNLIKKSLEDVTG-MDFLRSLTLFGEKAPPERVQ 219
28 -9.240PF12348.8; B8M2E9_TALSN/325-551; CLASP N terminal  ali follow..  51.............IKSLLDGILNSLRTTLSTTGCLLIQEIAKVCGPGIDNMVEILLQNMIKLCAGMKKISAQNANATVDAIISNVTYVPRILQ-----HLSFACQDKNVQPRLFAAGWLKTLKSSIEHGGGLDLVEKCIKKCLGDPNPGVRESMRGTFWTFYKIWPDRAEEIISTLDAKSKTLLE..................................................................... 227
29 -9.210PF12719.7; M3XT68_MUSPF/558-858; Nuclear condensing complex subunits, C-term domain  ali follow..  25...........GIIESLILPGIVSVHPVIRNLAVLCLGCCGLQNQD----FASKHFVLLLQVLQIDDVTIKISALKAIFDQLMKDAKEETATAKNVLKLLSDFLDSEVSELRTGAAEGLAKLMFSGLSSRILSRLVLLWYNPVTEEDVRLRHCLGVFFPMFAYASRTNQECFEEAFLPTLQTLASAPASSPLITNVAELLVDLTRPSGLNLQAKNSQDYQALSVHDNL-----AIKICNEILTCPCSPEIR... 290
30 -9.050PF07539.12; E5AF73_LEPMJ/886-1482; Down-regulated in metastasis  ali follow..  373.............LSRVGNLLRRSPSKDVLESGVQTVADMAPYVTGSVEARSM--IEIATFLLRQPNSRTKLGLLKILHEFICDQQNLHELFSTIYDAICPMFAFVHERTARNLLCDIVQDLAGTQEDLVSIAKLCYALNSFLDEPDFQCRSLAFDEINEHNYRLYSMKQWR---LAYNMLFFIKDNDELSIRVNASLSLRRLIEVSNSDEFKNFISTAVLPGIQSGVRETS...................... 597

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.