current user: public

If you have questions about the server, please let us know.

Query: PF05263.11; Q9CGR2_LACLA/1-125; Protein of unknown function (DUF722 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MADRLDLLLSDYMTGMLQVKINSRERWITREKHEERIGSGGSSSNTAPQERNYLIKEADKELGRLNDQKQTLDELMEVIQGTIAKDIIIARFKHRMSWHNVAIRVCLEESVARKQYISFKNTLRSLast
1 -66.100PF05263.11; Q9CGR2_LACLA/1-125; Protein of unknown function (DUF722 topsan)  ali  100  1MADRLDLLLSDYMTGMLQVKINSRERWITREKHEERIGSGGSSSNTAPQERNYLIKEADKELGRLNDQKQTLDELMEVIQGTIAKDIIIARFKHRMSWHNVAIRVCLEESVARKQYISFKNTLRS 125
2 -26.000PF07374.11; A0A141DZZ6_9VIRU/32-131; Protein of unknown function (DUF1492 topsan)  ali follow..  14.....................................GGQARKVDDVYTQLVVMKEAIEQDTKEVINRKLELGRLINKLKNPKSRSILRVTYITKMYVDDICDKMEISRTTFYTWRNMAISELN. 100
3 -11.800PF04297.14; YOFM_LACLA/3-103; Putative helix-turn-helix protein, YlxM / p13 like  ali follow..  1.............................................................IEKTNRMNTLFEFYATLLTDKQMNYI-ELYYADDYSLAEIAEEFNISRQAVYDNIKRTEKVLE. 62
4 -10.400PF06530.12; W1J5U0_9GAMM/1-120; Phage antitermination protein Q  ali follow..  12  1MRD-IQQVLVLW--------------------TTSDVNLKVGWSPVAAGFSGLLPASGTSRPTCSDEDGLIIDICVARLGREEEFDYIKQHYMLGYSKREIARDLRVSESLVRHKMQVAESFIAG 110
5 -10.100PF08281.12; Q89KH7_BRADU/124-177; Sigma-70, region 4  ali follow..  19  4.......................................................................LRRLLKHLPEKMQCAIEAVKL-DGLSVAEAAQRCHISESGVKVNIHRGLKTL.. 54
6 -9.780PF07638.11; Q7UFE5_RHOBA/9-192; ECF sigma factor  ali follow..  12  126.....................................................................DDGLERLFKVDPDSAKLVELRVF-AGLSITEAGELMKMSRSTAYRNWEFARTWFAV 180
7 -9.710PF16509.5; D6CK40_XANAP/7-92; TrfB plasmid transcriptional repressor  ali follow..  7.....................................................................ETLRPYLSRLKERNVEAIRQIMV-ESRQQTDVADELGVTKKAVSQMVGKAWQAHIE 61
8 -9.380PF08822.11; B0USA4_HISS2/1-164; Protein of unknown function (DUF1804 topsan)  ali follow..  10  4...............................................................................DEKVRALVRRYYVFDRFTLEQSAQKADVSFGTARRWKAQ....... 42
9 -8.930PF02796.15; UVP1_ECOLX/144-189; Helix-turn-helix domain of resolvase  ali follow..  12  5.............................................................................SLSEDDINEMKILLADPEMTVGAVAKRFNVSRMTIYRYTTK....... 45
10 -7.880PF05043.13; Q99XU9_STRP1/76-162; Mga helix-turn-helix domain  ali follow..  13  14...............................................................................HSQSFKLLETLFFRDFNSLEELAEELFVSLSTLKRLIKKTNAYLMH 59

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.