current user: public
If you have questions about the server, please let us know.

Query: PF05430.11; MNMC_VIBCH/119-246; S-adenosyl-L-methionine-dependent methyltransferase, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst PELAQFAQKLHKHYPLAIPECQRIVLNDGLVTLDLWFGDIKDCLPKVATQEQGLVDAWFLDGFAPSKNPEMWNQNLFAGMAKLAKHGCTCATFTSAGFVRRGLIDAGFAMKKVKGFGTKREMIAGSLSLast
1 -80.700PF05430.11; MNMC_VIBCH/119-246; S-adenosyl-L-methionine-dependent methyltransferase  ali  100  1PELAQFAQKLHKHYPLAIPECQRIVLNDGLVTLDLWFGDIKDCLPKVATQEQGLVDAWFLDGFAPSKNPEMWNQNLFAGMAKLAKHGCTCATFTSAGFVRRGLIDAGFAMKKVKGFGTKREMIAGSLS 128
2 -7.190PF01564.17; SPEE_SCHPO/71-256; Spermine/spermidine synthase domain  ali follow..  17  49.DIDEDVIKVSKQYLPEMSA----GFNHPKVKV--HIGDGFKFLQD----YQNTFDVIITDSSDPGPAEALFQKPYFQLLSDALRGGGVITTQAECMWIHLGV......................... 141
3 -7.170PF04725.12; W1NUL8_AMBTC/45-140; Photosystem II 10 kDa polypeptide PsbR  ali follow..  21  45...........................................................VDGYSPIYDENDWSPS--GDVYVGGSTGLLIWAVTLAGVLAGG.......................... 85
4 -7.100PF08486.10; R5WTA8_9FIRM/138-229; Stage II sporulation protein  ali follow..  19  16..........................................................YLEAVVPSEMPSGYHKEALKAQAVCAR------TYAWKQMQEGRLSKYGADV.................. 61
5 -7.020PF05706.12; CDKN3_HUMAN/1-168; Cyclin-dependent kinase inhibitor 3 (CDKN3)  ali follow..  13  110............................................................DGGTPDIAS----CEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAI...... 168
6 -6.670PF01234.17; INMT_MOUSE/1-260; NNMT/PNMT/TEMT family  ali follow..  14  159...................................................DCVLTFLAMECACPDIDT----RAALRRLAGLLKPGGHLGVYLEKEVVEKAIQDAGCQVLKCNCVSLSYSEAYCSHD 251
7 -6.610PF13358.6; D3VKI2_XENNA/117-263; DDE superfamily endonuclease  ali follow..  12  80..........................LSQKIHLILDGAGYHRSEIVKFFAEVLNIELHYLPPYSPNLNP----ERLWKYANEQIRNNVYFPDAKT................................. 145
8 -6.550PF15264.6; H3B4U0_LATCH/96-225; Tumour suppressing sub-chromosomal transferable candidate 4  ali follow..  9  65................................................................PDAHPERWTKYSLEDVEETSDRKNKMVALEFLEGLQKSREK....................... 107
9 -6.310PF12502.8; D5UN01_TSUPD/48-218; Protein of unknown function (DUF3710 topsan)  ali follow..  13  32..............................AQLQVEMSPEGQPVGVHLDTPAGRIT---PGVFAAPKTGGQWR-EVVTELADSLRENGAQVTIEDGHWGREVVGIQPDGVLRFIGVDGPRWMIRFVVA 125
10 -6.300PF06080.12; Q8YZS2_NOSS1/8-210; Protein of unknown function (DUF938 topsan)  ali follow..  9  99...................................................DAPIAAIVNINMIHISPWSA-CLGLLAGAGRILPPGGILYLYGNLEDVIAAAKQQNLQLHKTYQMPANNLSVVFQR. 203
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li Z, Ye Y, Godzik A. Flexible Structural Neighborhood--a database of protein structural similarities and alignments. Nucleic Acids Res. 2006 Jan 1;34(Database issue):D277-80.